DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17029 and Bpnt2

DIOPT Version :9

Sequence 1:NP_001261908.1 Gene:CG17029 / 39740 FlyBaseID:FBgn0036551 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_808398.1 Gene:Bpnt2 / 242291 MGIID:1915720 Length:356 Species:Mus musculus


Alignment Length:276 Identity:67/276 - (24%)
Similarity:105/276 - (38%) Gaps:73/276 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSAVSESKLKEYYDVALKLVLKCGPLMQEGYQKAKTEYKVKADFYDLVTVYDKQI-EDILTEGL 64
            |:|....|..|.:|     |:....|.:|     ..||..|.|...::: |::::| ||||.|  
Mouse   104 MTSGDVLSNRKMFY-----LLKTAFPNVQ-----INTEEHVDASDKEVI-VWNRKIPEDILKE-- 155

  Fly    65 VAAFPESLIIGEEESAVSQRQAELTDAPTWIIDPIDGTTNFIHRI-PHCCISVGLAINKELVVGI 128
            :||               .::........| |||:|.|..:...: .:....|.:|:|.:.|:|:
Mouse   156 IAA---------------PKEVPAESVTVW-IDPLDATQEYTEDLRKYVTTMVCVAVNGKPVLGV 204

  Fly   129 IYNPPANELFSAY------------KGHGAYLNGEP---IHTSKVTTIKQAVI---AYEISLIHA 175
            |:.|     ||.|            |...:|....|   :..|....:||..:   ..:.|:|.|
Mouse   205 IHKP-----FSEYTAWAMVDGGSNVKARSSYNEKTPKIIVSRSHAGMVKQVALQTFGNQTSIIPA 264

  Fly   176 AGVRDKNVKRLYKMASNATGTRCFGSAALTLCYVATGQCDAY-HVEDLKPWDIAAGAIILTEAGG 239
            .|..       ||:.           |.|.:..:...:.|.| ||..:|.|||.||..||...||
Mouse   265 GGAG-------YKVL-----------ALLDVPDMTQEKADLYIHVTYIKKWDICAGNAILKALGG 311

  Fly   240 TVCHTSGSKFDVMKPD 255
            .:...:|.:......|
Mouse   312 HMTTLNGEEISYTGSD 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17029NP_001261908.1 IMPase 13..261 CDD:238817 63/264 (24%)
Bpnt2NP_808398.1 IPPase 64..347 CDD:238818 67/276 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..104 67/276 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834909
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.