DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17026 and INM1

DIOPT Version :9

Sequence 1:NP_648820.1 Gene:CG17026 / 39739 FlyBaseID:FBgn0036550 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_011912.1 Gene:INM1 / 856442 SGDID:S000001088 Length:295 Species:Saccharomyces cerevisiae


Alignment Length:282 Identity:89/282 - (31%)
Similarity:127/282 - (45%) Gaps:57/282 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAASKSQIEELYDFIYPLAVRAGEILLEGYQNAGKAVALKDG-EFYNVVTAYDNQIEEFLVEKIL 64
            |....:.||:   |:..||......:::......|...||.| ...::|||.|.|:|:.:.|.:.
Yeast     1 MTIDLASIEK---FLCELATEKVGPIIKSKSGTQKDYDLKTGSRSVDIVTAIDKQVEKLIWESVK 62

  Fly    65 ARYPDHKFIGEEDTHKNDNVTKELTDAPTWIIDPIDGTSNFIKQIPHVSVSIGLSIKKQIVLGVV 129
            .:||..||||||...|.:.|   :||.||:||||||||:||:...|....|:||::.|:.|:||:
Yeast    63 TQYPTFKFIGEESYVKGETV---ITDDPTFIIDPIDGTTNFVHDFPFSCTSLGLTVNKEPVVGVI 124

  Fly   130 NNPAQNKLYTAKLGQGAFCNGKPIQVSSCEH------LNDANVA------------------YEV 170
            .||..|.|.:|..|.|...|.|.....|...      ||.:.||                  ||.
Yeast   125 YNPHINLLVSASKGNGMRVNNKDYDYKSKLESMGSLILNKSVVALQPGSAREGKNFQTKMATYEK 189

  Fly   171 CL------LHAPKIRNKHIKRIYHVGSNARRLLAYSAVVDSLCMVAAGNLDAFHIEDMYPWDCAA 229
            .|      :|.  .||        :||:| ..:||         :|.|.||::.....|.||..|
Yeast   190 LLSCDYGFVHG--FRN--------LGSSA-MTMAY---------IAMGYLDSYWDGGCYSWDVCA 234

  Fly   230 GYLLIREAGGVVTHPYGGPFDI 251
            |:.:::|.||.|.....|.:.|
Yeast   235 GWCILKEVGGRVVGANPGEWSI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17026NP_648820.1 IMPase 11..259 CDD:238817 86/272 (32%)
INM1NP_011912.1 IMPase 10..267 CDD:238817 86/273 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0483
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54074
OrthoFinder 1 1.000 - - FOG0000745
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100401
Panther 1 1.100 - - O PTHR20854
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.780

Return to query results.
Submit another query.