DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17026 and Impa1

DIOPT Version :9

Sequence 1:NP_648820.1 Gene:CG17026 / 39739 FlyBaseID:FBgn0036550 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_006530140.1 Gene:Impa1 / 55980 MGIID:1933158 Length:330 Species:Mus musculus


Alignment Length:277 Identity:96/277 - (34%)
Similarity:159/277 - (57%) Gaps:13/277 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EELYDFIYPLAVRAGEILLEGYQNAGKAVALKDGEFYNVVTAYDNQIEEFLVEKILARYPDHKFI 73
            :|..|:...||.:|||::.|..:|. ..|.:|... .::||..|.::|:.|:..|..:||.|.||
Mouse    59 QECMDYAVILARQAGEMIREALKNE-MDVMIKSSP-ADLVTVTDQKVEKMLMSSIKEKYPCHSFI 121

  Fly    74 GEEDTHKNDNVTKELTDAPTWIIDPIDGTSNFIKQIPHVSVSIGLSIKKQIVLGVVNNPAQNKLY 138
            |||.....:...  .|:.|||:|||||||:||:.:.|.|:||||..:.|::..|:|.:..::|:|
Mouse   122 GEESVAAGEKTV--FTEQPTWVIDPIDGTTNFVHRFPFVAVSIGFLVNKEMEFGIVYSCVEDKMY 184

  Fly   139 TAKLGQGAFCNGKPIQVSSCEHLNDANVAYEVCLLHAP---KIRNKHIKRIYHVGSNARRLLAYS 200
            |.:.|:||||||:.:|||..|.:..:.:..|:.....|   :|...:::::..:..:..|.:..:
Mouse   185 TGRKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRKPETLRIVLSNMEKLCSIPIHGIRSVGTA 249

  Fly   201 AVVDSLCMVAAGNLDAFHIEDMYPWDCAAGYLLIREAGGVVTHPYGGPFDIMKPDLICAGTETL- 264
            ||  ::|:||.|..||::...::.||.|...:::.|||||:....|||||:|...:|.|.:.|| 
Mouse   250 AV--NMCLVATGGADAYYEMGIHCWDMAGAGIIVTEAGGVLMDVTGGPFDLMSRRIIAANSITLA 312

  Fly   265 ---RAEIEHLIRKADQE 278
               ..|||.:..:.|.|
Mouse   313 KRIAKEIEIIPLQRDDE 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17026NP_648820.1 IMPase 11..259 CDD:238817 87/250 (35%)
Impa1XP_006530140.1 IMPase 61..307 CDD:238817 87/251 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834908
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54074
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000745
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100401
Panther 1 1.100 - - O PTHR20854
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.710

Return to query results.
Submit another query.