DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17026 and impa1

DIOPT Version :9

Sequence 1:NP_648820.1 Gene:CG17026 / 39739 FlyBaseID:FBgn0036550 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001017057.1 Gene:impa1 / 549811 XenbaseID:XB-GENE-1004318 Length:280 Species:Xenopus tropicalis


Alignment Length:295 Identity:105/295 - (35%)
Similarity:159/295 - (53%) Gaps:37/295 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KSQIEELYDFIYPLAVRAGEILLEGYQNAGKAVALKD-------GEFYNVVTAYDNQIEEFLVEK 62
            :.|.:|..||...:|.:||.::         ..|||:       ....::|||.|.::||.|:..
 Frog     2 EDQWQESMDFAILIARKAGSVV---------CAALKEDVSIMVKSSPADLVTATDQKVEEMLISS 57

  Fly    63 ILARYPDHKFIGEEDTHKNDNVTKELTDAPTWIIDPIDGTSNFIKQIPHVSVSIGLSIKKQIVLG 127
            |..:||.|.|||||........|  |||.|||||||||||:||:.:.|.|:||||.::.||:..|
 Frog    58 IKEKYPSHSFIGEESVAAGAGST--LTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKQVEFG 120

  Fly   128 VVNNPAQNKLYTAKLGQGAFCNGKPIQVSSCEHLNDANVAYEVCLLHAPKIRNKHIKRIYHVGSN 192
            ||.:..::|:||.:.|:||||||:.:|||..:.:..:.:..|:.....|::    ||.:.   ||
 Frog   121 VVYSCVEDKMYTGRKGKGAFCNGQKLQVSGQKDITKSMIITELGSNRNPEV----IKMVL---SN 178

  Fly   193 ARRLL--------AYSAVVDSLCMVAAGNLDAFHIEDMYPWDCAAGYLLIREAGGVVTHPYGGPF 249
            ..|||        |......::|:||.|..||::...::.||.||..::|.||||||....||.|
 Frog   179 MERLLCIPIHGIRAVGTAAVNMCLVATGGADAYYEMGIHCWDMAAASVIITEAGGVVLDATGGAF 243

  Fly   250 DIMKPDLICAGT----ETLRAEIEHLIRKADQEKH 280
            |:|...:|.|.:    |.:..|::.:..:.|..|:
 Frog   244 DLMSCRVIAASSRDIAERIAKELQIIPLERDDGKN 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17026NP_648820.1 IMPase 11..259 CDD:238817 98/262 (37%)
impa1NP_001017057.1 IMPase 9..254 CDD:238817 98/262 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54074
OrthoDB 1 1.010 - - D406919at33208
OrthoFinder 1 1.000 - - FOG0000745
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20854
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.