DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17026 and BPNT2

DIOPT Version :9

Sequence 1:NP_648820.1 Gene:CG17026 / 39739 FlyBaseID:FBgn0036550 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_060283.3 Gene:BPNT2 / 54928 HGNCID:26019 Length:359 Species:Homo sapiens


Alignment Length:288 Identity:68/288 - (23%)
Similarity:115/288 - (39%) Gaps:44/288 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VRAGEILLE---GYQNAGKAVALKDGE-------FYNVVTAY-------DNQIEEFLVEKILARY 67
            ||...:|.|   |....|....:..|:       ||.:.||:       :..::....|.||.  
Human    84 VRESNVLHEKSKGKTREGAEDKMTSGDVLSNRKMFYLLKTAFPSVQINTEEHVDAADQEVILW-- 146

  Fly    68 PDHKFIGEEDTHKNDNVTKEL-TDAPTWIIDPIDGTSNFIKQI-PHVSVSIGLSIKKQIVLGVVN 130
             |||.  .||..|.....||: .::.|..|||:|.|..:.:.: .:|:..:.:::..:.:|||::
Human   147 -DHKI--PEDILKEVTTPKEVPAESVTVWIDPLDATQEYTEDLRKYVTTMVCVAVNGKPMLGVIH 208

  Fly   131 NPAQNKLYTAKLGQGAFCNGKPIQVSSCEHLNDANVAYEVCLLHAPKIRNKHIK------RIYHV 189
            .|...  |||    .|..:|.. .|.:....|:......|...|:..::...::      .|...
Human   209 KPFSE--YTA----WAMVDGGS-NVKARSSYNEKTPRIVVSRSHSGMVKQVALQTFGNQTTIIPA 266

  Fly   190 GSNARRLLAYSAVVDSLCMVAAGNLDAF-HIEDMYPWDCAAGYLLIREAGGVVTHPYGGPFDIMK 253
            |....::||...|.|.    :....|.: |:..:..||..||..:::..||.:|...|.......
Human   267 GGAGYKVLALLDVPDK----SQEKADLYIHVTYIKKWDICAGNAILKALGGHMTTLSGEEISYTG 327

  Fly   254 PDLICAG-TETLRAEIEHLIRK-ADQEK 279
            .|.|..| ..::|...:.|:|| .|.||
Human   328 SDGIEGGLLASIRMNHQALVRKLPDLEK 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17026NP_648820.1 IMPase 11..259 CDD:238817 60/264 (23%)
BPNT2NP_060283.3 IPPase 66..349 CDD:238818 63/280 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..106 4/19 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144800
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.