DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17026 and CG7789

DIOPT Version :9

Sequence 1:NP_648820.1 Gene:CG17026 / 39739 FlyBaseID:FBgn0036550 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_651728.1 Gene:CG7789 / 43516 FlyBaseID:FBgn0039698 Length:306 Species:Drosophila melanogaster


Alignment Length:321 Identity:69/321 - (21%)
Similarity:117/321 - (36%) Gaps:90/321 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAASKSQIEELYDFIYPLAVRAGEILLEGYQNAGKAVALKDGEFYNVV--------TAYDNQIEE 57
            |||:...|..:.......|.|||.|:.:         .||.|:. .:|        |..|...:.
  Fly     1 MAATAPVIMRVMASSISTAKRAGGIIRD---------VLKKGDL-GIVDKGKNDPQTEADRSAQR 55

  Fly    58 FLVEKILARYPDHKFIGEE---DTHKNDN-VTKEL------------------TDAPTWIIDPID 100
            .::..:..::|..|.||||   |.:..|: :..||                  .|...| :||:|
  Fly    56 CIIASLAKKFPTVKIIGEEGGSDLNVCDDWLVNELDEEFLQHSCPAEWKDVKPEDFVIW-VDPLD 119

  Fly   101 GTSNFIK-QIPHVSVSIGLSIKKQIVLGVVNNPAQNK--------LYTAK-LGQGAFC-----NG 150
            ||:.:.: .:.||:|.||:::|...|.|:::.|...:        ::..| ||.|.|.     .|
  Fly   120 GTAEYTQGHVEHVTVLIGIAVKDAAVGGIIHQPFYQQPDGEMGRTIWGLKGLGTGGFTAVPAPAG 184

  Fly   151 KPIQVSSCEHLNDANVAYEVCLLHAPKIRNKHIKRIYHVGSNARRLLAYSAVVDSLCMVAAGNLD 215
            :.|..::..|.|         .||...:.......:..||....::|          .:..|...
  Fly   185 QFIITTTRSHSN---------ALHQQALNAFASTEVLKVGGAGFKVL----------QLLEGKAH 230

  Fly   216 A--FHIEDMYPWDCAAGYLLIREAGGVVTHPYGGPFDIMKPDLICAGTETLRAEIEHLIRK 274
            |  |.......||..|...::...||.:|:..|..:             ...|::||:.|:
  Fly   231 AYVFATPGCKKWDTCAPEAVLEAQGGCLTNINGEHY-------------AYNADVEHVNRQ 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17026NP_648820.1 IMPase 11..259 CDD:238817 61/294 (21%)
CG7789NP_651728.1 IPPase 12..294 CDD:238818 65/310 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445175
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.