DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17026 and Ipp

DIOPT Version :9

Sequence 1:NP_648820.1 Gene:CG17026 / 39739 FlyBaseID:FBgn0036550 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_731872.1 Gene:Ipp / 41701 FlyBaseID:FBgn0016672 Length:375 Species:Drosophila melanogaster


Alignment Length:307 Identity:65/307 - (21%)
Similarity:108/307 - (35%) Gaps:112/307 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EILLEGYQNAGKAVALKDGEFYNVVTAYDNQIEEFLVEKI--LARYPDHKFIGEEDTHKNDNVTK 86
            :.:|.|:::|..|:|.   |.:..|:        |..||:  :|:.||....|            
  Fly   114 QAVLSGHEDAASALAT---EVHRDVS--------FSSEKLGEIAQLPDELDYG------------ 155

  Fly    87 ELTDAPTWIIDPIDGTSNFIK------QIPHVSVSIGLSIKKQI-----------VLGVVNNPAQ 134
               :...| |||||.|:.:|.      ..|.:: |.||.....:           |:|||..|..
  Fly   156 ---NLGIW-IDPIDATAEYISGDTMFTDFPGIT-STGLDCVTVLIGVYERDTGVPVMGVVAQPFG 215

  Fly   135 NKLYTAKLGQGAFCNGKPIQVSSCEHLNDANVAYEVCLLHAPKIRNKHIKRIYHVGSNARRLLAY 199
            .||.                    |::..:::.:.|||   |.:|..:..  :......|||..:
  Fly   216 EKLE--------------------ENVYSSSMFWGVCL---PTVRAHNCD--FEARDENRRLGIF 255

  Fly   200 SAVVDSLCM---VAAGNLDAF-------------HIEDMY--------PWDCAAGYLLIREAGGV 240
            |:...|..:   :..|...||             |..|:|        .||..|...::|..|| 
  Fly   256 SSSEQSDILQRFLDLGYEFAFSAGAGHKALKVITHEVDVYLLSKGSTFKWDTCAPQAILRALGG- 319

  Fly   241 VTHPYGGPFDIMKPDLICAGTETLRAEIEHLIR----KADQEKHVGG 283
                     |::  |...:..|.....:::||.    .||.:::.||
  Fly   320 ---------DVL--DYAASVAEQKAVPLKYLIEDAEADADWKRNAGG 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17026NP_648820.1 IMPase 11..259 CDD:238817 58/277 (21%)
IppNP_731872.1 IPPase 10..371 CDD:238818 65/307 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445171
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.