DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17026 and IMPA2

DIOPT Version :9

Sequence 1:NP_648820.1 Gene:CG17026 / 39739 FlyBaseID:FBgn0036550 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_055029.1 Gene:IMPA2 / 3613 HGNCID:6051 Length:288 Species:Homo sapiens


Alignment Length:277 Identity:97/277 - (35%)
Similarity:161/277 - (58%) Gaps:13/277 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EELYDFIYPLAVRAGEILLEGYQNAGKAVALKDGEFYNVVTAYDNQIEEFLVEKILARYPDHKFI 73
            ||.:.....||:|||:|:.:..... |.|:.|... .::||..|:.:|:.::.::..|:|.|:||
Human    17 EECFQAAVQLALRAGQIIRKALTEE-KRVSTKTSA-ADLVTETDHLVEDLIISELRERFPSHRFI 79

  Fly    74 GEEDTHKNDNVTKELTDAPTWIIDPIDGTSNFIKQIPHVSVSIGLSIKKQIVLGVVNNPAQNKLY 138
            .||.........  ||.:|||||||||||.||:.:.|.|:||||.::::::..||:.:..:.:||
Human    80 AEEAAASGAKCV--LTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLY 142

  Fly   139 TAKLGQGAFCNGKPIQVSSCEHLNDANVAYEVCLLHAP---KIRNKHIKRIYHVGSNARRLLAYS 200
            |.:.|:||||||:.::||....|:.|.|..|:.....|   |:...:::|:.|..::..|::..|
Human   143 TGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSS 207

  Fly   201 AVVDSLCMVAAGNLDAFHIEDMYPWDCAAGYLLIREAGGVVTHPYGGPFDIMKPDLICAGTETLR 265
            .:  :||.:|:|..||::...::.||.||..::||||||:|....|||.|:|...::.|.|.   
Human   208 TL--ALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTR--- 267

  Fly   266 AEIEHLIRKADQEKHVG 282
             |:..||.:|.|..:.|
Human   268 -EMAMLIAQALQTINYG 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17026NP_648820.1 IMPase 11..259 CDD:238817 87/250 (35%)
IMPA2NP_055029.1 IMPase 19..265 CDD:238817 87/251 (35%)
Substrate binding 103..106 2/2 (100%)
Substrate binding 205..207 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144804
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1598
OMA 1 1.010 - - QHG54074
OrthoDB 1 1.010 - - D406919at33208
OrthoFinder 1 1.000 - - FOG0000745
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100401
Panther 1 1.100 - - O PTHR20854
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.670

Return to query results.
Submit another query.