DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17026 and IMPA1

DIOPT Version :9

Sequence 1:NP_648820.1 Gene:CG17026 / 39739 FlyBaseID:FBgn0036550 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001138350.1 Gene:IMPA1 / 3612 HGNCID:6050 Length:336 Species:Homo sapiens


Alignment Length:277 Identity:102/277 - (36%)
Similarity:163/277 - (58%) Gaps:13/277 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EELYDFIYPLAVRAGEILLEGYQNAGKAVALKDGEFYNVVTAYDNQIEEFLVEKILARYPDHKFI 73
            :|..|:...||.:|||::.|..:|. ..|.||... .::|||.|.::|:.|:..|..:||.|.||
Human    65 QECMDYAVTLARQAGEVVCEAIKNE-MNVMLKSSP-VDLVTATDQKVEKMLISSIKEKYPSHSFI 127

  Fly    74 GEEDTHKNDNVTKELTDAPTWIIDPIDGTSNFIKQIPHVSVSIGLSIKKQIVLGVVNNPAQNKLY 138
            |||.....:.  ..|||.|||||||||||:||:.:.|.|:||||.::.|:|..|||.:..:.|:|
Human   128 GEESVAAGEK--SILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMY 190

  Fly   139 TAKLGQGAFCNGKPIQVSSCEHLNDANVAYEVCLLHAPK-IRN--KHIKRIYHVGSNARRLLAYS 200
            ||:.|:||||||:.:|||..|.:..:.:..|:.....|: :|.  .::::::.:..:..|.:..:
Human   191 TARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTA 255

  Fly   201 AVVDSLCMVAAGNLDAFHIEDMYPWDCAAGYLLIREAGGVVTHPYGGPFDIMKPDLICAG----T 261
            ||  ::|:||.|..||::...::.||.|...:::.|||||:....|||||:|...:|.|.    .
Human   256 AV--NMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILA 318

  Fly   262 ETLRAEIEHLIRKADQE 278
            |.:..||:.:..:.|.|
Human   319 ERIAKEIQVIPLQRDDE 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17026NP_648820.1 IMPase 11..259 CDD:238817 95/250 (38%)
IMPA1NP_001138350.1 IMPase 67..313 CDD:238817 95/251 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144796
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54074
OrthoDB 1 1.010 - - D406919at33208
OrthoFinder 1 1.000 - - FOG0000745
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100401
Panther 1 1.100 - - O PTHR20854
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.720

Return to query results.
Submit another query.