DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17026 and Bpnt2

DIOPT Version :9

Sequence 1:NP_648820.1 Gene:CG17026 / 39739 FlyBaseID:FBgn0036550 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001008772.2 Gene:Bpnt2 / 312952 RGDID:1306455 Length:356 Species:Rattus norvegicus


Alignment Length:294 Identity:68/294 - (23%)
Similarity:113/294 - (38%) Gaps:56/294 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VRAGEILLE---GYQNAGKAVALKDGE-------FYNVVTAYDN-QI----------EEFLV--E 61
            ||...:|.|   |....|....:..|:       ||.:.||:.| ||          :|.:|  .
  Rat    82 VRESNVLHEKSKGKTREGAEDKMTSGDVLSNRKMFYLLKTAFPNVQINTEEHVDASDKEVIVWNR 146

  Fly    62 KILARYPDHKFIGEEDTHKNDNVTKEL-TDAPTWIIDPIDGTSNFIKQI-PHVSVSIGLSIKKQI 124
            ||           .||..|.....||: .::.|..|||:|.|..:.:.: .:|:..:.:::..:.
  Rat   147 KI-----------PEDILKEIAAPKEVPAESVTVWIDPLDATQEYTEDLRKYVTTMVCVAVNGKP 200

  Fly   125 VLGVVNNPAQNKLYTAKLGQGAFCNGKPIQVSSCEHLNDANVAYEVCLLHAPKIRNKHIKR---- 185
            ||||::.|.......|.:..|:       .|.:....|:......|...||..::...::.    
  Rat   201 VLGVIHKPFSEYTAWAMVDSGS-------NVKARSSYNEKTPKIIVSRSHAGMVKQVALQTFGNQ 258

  Fly   186 --IYHVGSNARRLLAYSAVVDSLCMVAAGNLDAF-HIEDMYPWDCAAGYLLIREAGGVVTHPYGG 247
              |...|....::||...|.|    :.....|.: |:..:..||..||..:::..||.:|...|.
  Rat   259 TLIIPAGGAGYKVLALLDVPD----MTQEKADLYIHVTYIKKWDICAGNAILKALGGHMTTLSGE 319

  Fly   248 PFDIMKPDLICAG-TETLRAEIEHLIRK-ADQEK 279
            .......|.|..| ..::|...:.|:|| .|.||
  Rat   320 EISYTGSDGIEGGLLASIRMNHQALVRKLPDLEK 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17026NP_648820.1 IMPase 11..259 CDD:238817 60/270 (22%)
Bpnt2NP_001008772.2 IPPase 64..347 CDD:238818 63/286 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 82..104 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338497
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.