DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17026 and Impa2

DIOPT Version :9

Sequence 1:NP_648820.1 Gene:CG17026 / 39739 FlyBaseID:FBgn0036550 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_757378.1 Gene:Impa2 / 282636 RGDID:628692 Length:290 Species:Rattus norvegicus


Alignment Length:277 Identity:101/277 - (36%)
Similarity:164/277 - (59%) Gaps:13/277 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EELYDFIYPLAVRAGEILLEGYQNAGKAVALKDGEFYNVVTAYDNQIEEFLVEKILARYPDHKFI 73
            :|.::....||:|||:|:.:..... |.|:.|... .::||..|:::|:.:|.::..|:|.|:||
  Rat    19 DECFEVAVQLALRAGQIIRKALTEE-KHVSTKTSA-ADLVTETDHRVEDLIVSELRKRFPSHRFI 81

  Fly    74 GEEDTHKNDNVTKELTDAPTWIIDPIDGTSNFIKQIPHVSVSIGLSIKKQIVLGVVNNPAQNKLY 138
            .||.|.......  ||.:|||||||||||.||:.:.|.|:||||.::.:::..||:::..:.:||
  Rat    82 AEEATASGAKCV--LTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVHQELEFGVIHHCTEERLY 144

  Fly   139 TAKLGQGAFCNGKPIQVSSCEHLNDANVAYEVCLLHAP---KIRNKHIKRIYHVGSNARRLLAYS 200
            |.:.||||||||:.:|||....|..|.|..|:.....|   |:...:::|:.|..::..|::..|
  Rat   145 TGRRGQGAFCNGQRLQVSRETDLAKALVLTEIGPKRDPDTLKVFLSNMERLLHAKAHGVRVIGSS 209

  Fly   201 AVVDSLCMVAAGNLDAFHIEDMYPWDCAAGYLLIREAGGVVTHPYGGPFDIMKPDLICAGTETLR 265
            .:  :||.:|:|..||::...::.||.||..::||||||:|....|||.|:|...::.|||.   
  Rat   210 TL--ALCYLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMSCRVVAAGTR--- 269

  Fly   266 AEIEHLIRKADQEKHVG 282
             |:..||.:|.|..:.|
  Rat   270 -EMAVLIAQALQTINYG 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17026NP_648820.1 IMPase 11..259 CDD:238817 91/250 (36%)
Impa2NP_757378.1 IMPase 21..266 CDD:238817 91/250 (36%)
Substrate binding. /evidence=ECO:0000250 105..108 2/2 (100%)
Substrate binding. /evidence=ECO:0000250 207..209 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338501
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54074
OrthoDB 1 1.010 - - D406919at33208
OrthoFinder 1 1.000 - - FOG0000745
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100401
Panther 1 1.100 - - O PTHR20854
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.720

Return to query results.
Submit another query.