DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17026 and tol1

DIOPT Version :9

Sequence 1:NP_648820.1 Gene:CG17026 / 39739 FlyBaseID:FBgn0036550 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_588230.1 Gene:tol1 / 2538954 PomBaseID:SPCC1753.04 Length:353 Species:Schizosaccharomyces pombe


Alignment Length:317 Identity:69/317 - (21%)
Similarity:109/317 - (34%) Gaps:104/317 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AVRAGEILLEGYQN------AGKAVALKDGEFYNVVTAYDNQIEEFLVEKILARYPDHKFIGEED 77
            |||....|.|...|      :......||.:  :.||..|...:..::..:...:|:...:||||
pombe    13 AVRRASYLTEKVFNQLIKEKSAAGALTKDDK--SPVTIGDFGAQAIVISMLKDAFPNDPIVGEED 75

  Fly    78 --------------------THKNDNVTKEL---------------------TDAPTWIIDPIDG 101
                                |.::....|||                     .:...|.:|||||
pombe    76 SDFLRENTQTCSRVWELVQETIQHATEYKELGQIKSAEEMMSIIDQGSYHGGRNGRMWTLDPIDG 140

  Fly   102 TSNFIKQI-------------PHVSVSIGL-----------SIKKQIVLGVVNNPA--QNKLYTA 140
            |..|::..             |.|| :||.           :..|.|::..|.|..  |..|:..
pombe   141 TKGFLRGAQYAICLALIENGKPVVS-AIGCPNLPYDFNQPETSPKGIIMSAVRNHGCFQYSLHNE 204

  Fly   141 KLGQGAFCNGKPIQV--SSCEHLNDANVAYEVCLLHAPKIRNKHIKRIYHVGSNARRLLAYSAVV 203
            ||        :|:||  ...::..|:.....|...|:.:...:.|.:...:.....::       
pombe   205 KL--------EPVQVHMQDVQNTKDSKFCEGVEAGHSMQGTQEEIAKYLGITRGPTKM------- 254

  Fly   204 DS---LCMVAAGNLDAF-------HIEDMYPWDCAAGYLLIREAGGVVTHPYGGPFD 250
            ||   ...:|.|:.|.:       ..|:.. ||.|.|.||:.||||||:..:|.|.|
pombe   255 DSQAKYASLARGDGDIYLRLPTKMTFEEKI-WDHAGGSLLVEEAGGVVSDMFGKPLD 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17026NP_648820.1 IMPase 11..259 CDD:238817 69/317 (22%)
tol1NP_588230.1 bisphos_HAL2 2..352 CDD:273558 69/317 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 47 1.000 Domainoid score I3498
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I2070
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.