DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17026 and ttx-7

DIOPT Version :9

Sequence 1:NP_648820.1 Gene:CG17026 / 39739 FlyBaseID:FBgn0036550 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001122453.2 Gene:ttx-7 / 172477 WormBaseID:WBGene00008765 Length:285 Species:Caenorhabditis elegans


Alignment Length:278 Identity:99/278 - (35%)
Similarity:156/278 - (56%) Gaps:13/278 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EELY-DFIYPLAVRAGEILLEGYQNAGKAVALKDGEFYNVVTAYDNQIEEFLVEKILARYPDHKF 72
            |::: |:...|..:||.::...:.:....|..|... .::||..|..:|:.|:|.:..|:..|:|
 Worm    10 EQVFVDYAIELVKKAGTLVRTAFDSPESKVDTKSSN-TDLVTETDQAVEKLLIEGLSERFKGHRF 73

  Fly    73 IGEEDTHKNDNVTKELTDAPTWIIDPIDGTSNFIKQIPHVSVSIGLSIKKQIVLGVVNNPAQNKL 137
            ||||.......:  |.||||||||||||||:||:.:||.:::.:||:|||||..|:|.||..|:|
 Worm    74 IGEESVAGGAKI--EWTDAPTWIIDPIDGTTNFVHRIPMIAICVGLAIKKQIRAGIVYNPITNEL 136

  Fly   138 YTAKLGQGAFCNGKPIQVSSCEHLNDANVAYEVCLLHAPK-------IRNKHIKRIYHVGSNARR 195
            |.|:||:|||.||.||:.|..:.|:...:...:.|.:..:       |...:::.....|....|
 Worm   137 YLAQLGKGAFKNGFPIRASKNQLLSKGVLCQSLGLHNRVQFGDRWLDIAQSNMRNQVMAGVRGHR 201

  Fly   196 LLAYSAVVDSLCMVAAGNLDAFHIEDMYPWDCAAGYLLIREAGGVVTHPYGGPFDIMKPDLICAG 260
            ....:|:  ::.|||.|:.|.:....::.||.||..:::.|||||||.|.|.|||:|...::|||
 Worm   202 SFGSAAI--NMVMVAQGSCDGYVEYGIHAWDVAAPSIIVTEAGGVVTDPTGSPFDVMSRKVLCAG 264

  Fly   261 TETLRAEIEHLIRKADQE 278
            |..|..::...:...|.|
 Worm   265 TAELGRDLSACLTHVDFE 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17026NP_648820.1 IMPase 11..259 CDD:238817 91/255 (36%)
ttx-7NP_001122453.2 IMPase 13..263 CDD:238817 91/254 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54074
OrthoDB 1 1.010 - - D406919at33208
OrthoFinder 1 1.000 - - FOG0000745
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100401
Panther 1 1.100 - - O PTHR20854
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.