DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17026 and impa2

DIOPT Version :9

Sequence 1:NP_648820.1 Gene:CG17026 / 39739 FlyBaseID:FBgn0036550 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_002936126.2 Gene:impa2 / 100379805 XenbaseID:XB-GENE-1012262 Length:309 Species:Xenopus tropicalis


Alignment Length:282 Identity:97/282 - (34%)
Similarity:159/282 - (56%) Gaps:19/282 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ASKSQIEELYDFIYPLAVRAGEILLEGYQNAGKAVALKDGEFYNVVTAYDNQIEEFLVEKILARY 67
            |::...:|..:....||:|||:::.:..... |.|:.|. ...::||..|:.:||.::..:..::
 Frog    32 AAEDPWKECMETAVQLALRAGQVIKKALTEE-KRVSTKT-SVVDLVTETDHFVEELIISALREKF 94

  Fly    68 PDHKFIGEEDTHKNDNVTKELTDAPTWIIDPIDGTSNFIKQIPHVSVSIGLSIKKQIVLGVVNNP 132
            |.|:|||||.|.......  |||:|||||||||||.||:.:.|.|:||||.::.:::..||:.:.
 Frog    95 PLHRFIGEESTSAGSKCV--LTDSPTWIIDPIDGTCNFVHRFPPVAVSIGFAVNRELEFGVIYHC 157

  Fly   133 AQNKLYTAKLGQGAFCNGKPIQVSSCEHLNDANVAYEVCLLHAPKIRNKHIKRIYHVGSNARRLL 197
            ....:||.:.|.|||||.:.:.|::...:.:|.:..|:    .|| |:....::: :| |..:||
 Frog   158 TNGNMYTGRKGHGAFCNEERLHVTNETGIRNALILTEI----GPK-RDPATLKLF-LG-NMEKLL 215

  Fly   198 AYSA----VVDS----LCMVAAGNLDAFHIEDMYPWDCAAGYLLIREAGGVVTHPYGGPFDIMKP 254
            .:.|    |:.|    ||.:|:|..||::...::.||.||..::||||||||....|||.|:|..
 Frog   216 KFQAHGIRVIGSSTLALCHIASGAADAYYQYGLHCWDLAAATVIIREAGGVVIDTTGGPLDLMSC 280

  Fly   255 DLICAGTETLRAEIEHLIRKAD 276
            .::.|||..|...|...::..|
 Frog   281 RVVAAGTTELAQSIAQELQTID 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17026NP_648820.1 IMPase 11..259 CDD:238817 89/255 (35%)
impa2XP_002936126.2 IMPase 40..285 CDD:238817 89/255 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D406919at33208
OrthoFinder 1 1.000 - - FOG0000745
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.