DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10516 and SPSB4

DIOPT Version :9

Sequence 1:NP_648819.2 Gene:CG10516 / 39738 FlyBaseID:FBgn0036549 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_543138.1 Gene:SPSB4 / 92369 HGNCID:30630 Length:273 Species:Homo sapiens


Alignment Length:227 Identity:61/227 - (26%)
Similarity:102/227 - (44%) Gaps:37/227 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 WHATDES-DAVVTDRD-IIF--HPTYSQGTAIVRGEQALKTNMVHFWEMRVITTLAGTDVMFGIG 113
            |:..|.| :..|.|.| :.|  ||. :|.|..:||:.. ....:|.|::.......||..:.|:.
Human    56 WNPEDRSLNVFVKDDDRLTFHRHPV-AQSTDGIRGKVG-HARGLHAWQINWPARQRGTHAVVGVA 118

  Fly   114 TESVNLGQFKFHFVSALGTNAQSWGFSYS-GRIQHCGELLP---Y------GQKFSQGCLIGVCL 168
            |....|  ....:.:.:|::|:|||:... .|:.|.|:..|   |      .:.|:....:.|.|
Human   119 TARAPL--HSVGYTALVGSDAESWGWDLGRSRLYHDGKNQPGVAYPAFLGPDEAFALPDSLLVVL 181

  Fly   169 DRTRGHLEFYLNRRSLGVAYTNVPTDPDVKIYPMVCST--AAKSVIRLIN-CTSQPVTL------ 224
            |...|.|.|.::.:.||||:..:   ...|:||:|.:.  ..:..:|.|| ...:|:.|      
Human   182 DMDEGTLSFIVDGQYLGVAFRGL---KGKKLYPVVSAVWGHCEVTMRYINGLDPEPLPLMDLCRR 243

  Fly   225 QLRSFQALSRQPLKLAELRQMP---GLKGIMQ 253
            .:||  ||.||  :|.::..:|   .||..:|
Human   244 SIRS--ALGRQ--RLQDISSLPLPQSLKNYLQ 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10516NP_648819.2 SPRY_SOCS3 51..233 CDD:293936 53/202 (26%)
SPSB4NP_543138.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
SPRY_SOCS1-2-4 54..227 CDD:293963 46/177 (26%)
SOCS 232..273 CDD:383010 13/44 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3953
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.