DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10516 and Fsn

DIOPT Version :9

Sequence 1:NP_648819.2 Gene:CG10516 / 39738 FlyBaseID:FBgn0036549 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_610849.1 Gene:Fsn / 36460 FlyBaseID:FBgn0043010 Length:255 Species:Drosophila melanogaster


Alignment Length:265 Identity:65/265 - (24%)
Similarity:103/265 - (38%) Gaps:69/265 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LLPPYQEACNPGFCDCPFPNSIEVTNHKGHIPDLVRCQ--CG------EDESGNVNAWRWHATD- 57
            ::.|....||        .|.:||......:.||..|.  |.      .||:.:|  ||||..: 
  Fly     1 MVDPVAALCN--------YNVLEVIFSYLELDDLSHCSQVCKSWYHFLNDENSDV--WRWHCLNK 55

  Fly    58 ------ESDAVVT--------------------DRDIIFHPT--------YSQGTAIVRGEQALK 88
                  :||.:.:                    .|::...|.        .:|.|...||:...:
  Fly    56 LPKESLKSDLLASVSTYKTKLRAYFHAWSPNDCSRNVYIKPNGFTLHRNPVAQSTDAARGKIGFR 120

  Fly    89 TNMVHFWEMRVITTLAGTDVMFGIGTESVNLGQFKFH-FVSALGTNAQSWGFS-------YSGRI 145
            ... |.||: :.....||..:.||.|:...|   :.| :|:.||::.||||::       ::|.:
  Fly   121 HGR-HTWEV-IWEGPLGTVAVIGISTKEAAL---QCHGYVALLGSDDQSWGWNLVENHLLHNGDM 180

  Fly   146 QHCGELLPYGQKFSQGCLIGVCLDRTRGHLEFYLNRRSLGVAYTNVPTDPDVKIYPMVCSTAAKS 210
            |....||....|:..|..|.|.||.....|.|..|...||||:..:   ||.|:||.|.:....:
  Fly   181 QGSYPLLNNAPKYQVGERIRVILDCEDNTLSFEKNYEFLGVAFRGL---PDKKLYPTVSAVYGNT 242

  Fly   211 VIRLI 215
            .:.::
  Fly   243 EVSMV 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10516NP_648819.2 SPRY_SOCS3 51..233 CDD:293936 52/208 (25%)
FsnNP_610849.1 F-box-like 13..54 CDD:289689 13/42 (31%)
SPRY_Fbox 81..255 CDD:293964 46/175 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469110
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3953
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12245
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.