DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10516 and gus

DIOPT Version :10

Sequence 1:NP_648819.2 Gene:CG10516 / 39738 FlyBaseID:FBgn0036549 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_610158.3 Gene:gus / 35478 FlyBaseID:FBgn0026238 Length:279 Species:Drosophila melanogaster


Alignment Length:207 Identity:50/207 - (24%)
Similarity:71/207 - (34%) Gaps:60/207 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 EKEMEEKIRSY---INRGRLSYEG--DDEKRDVMNKIVSKLRSEGYNASLSKTSWDSSFDHREGC 112
            ::|...:.|.|   .||.| .|.|  .|..||..:....:.|....:.|.||.|.....| ||..
  Fly    74 DRERSHRDRDYHRDRNRDR-EYGGRYRDHYRDHRDDQYRRDRRSSRSRSRSKESRSRDRD-RERD 136

  Fly   113 RVFTCSRKYEYIDAMVIGDSDRDG-VSKLKRVIID-LDFKTQFELARQTEAYKDMTEMLPTVFVA 175
            |    .|...:.|    ..|.||| :|:.:|...| |..:.:.|||                   
  Fly   137 R----ERNRSHRD----DRSSRDGPISRPERTAQDRLSAEIEQELA------------------- 174

  Fly   176 TEGRLRRVVSLVCGEMKKSMKKEGMSRPPWRTSRYMQSKWLPENCRRDAGCKKGSWSWSVFDDGG 240
               .|||.     .:||:::|::       :..:..||.....|         |..|.......|
  Fly   175 ---NLRRQ-----HDMKEALKRQ-------QQQQQQQSAGASSN---------GDDSQDDSKPSG 215

  Fly   241 EGIGEARSWTVS 252
            ..:||.|..|.|
  Fly   216 RVVGERRPTTSS 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10516NP_648819.2 SPRY_SOCS3 51..233 CDD:293936 43/186 (23%)
gusNP_610158.3 SPRY_SOCS1-2-4 56..229 CDD:293963 50/207 (24%)
SOCS_SSB1_4 234..276 CDD:239688
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.