DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10516 and Trim65

DIOPT Version :10

Sequence 1:NP_648819.2 Gene:CG10516 / 39738 FlyBaseID:FBgn0036549 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001129186.1 Gene:Trim65 / 303684 RGDID:1559497 Length:518 Species:Rattus norvegicus


Alignment Length:168 Identity:33/168 - (19%)
Similarity:59/168 - (35%) Gaps:64/168 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 VRGEQALKTNMVHFWEMRVITTLAGTDVMFGI----------GTESVNLGQFKFHFVSALGTNA- 134
            |:..|:.:|.. |:||:|.    :...:..|:          ||.:.|:|:..:.:...:..:: 
  Rat   370 VQCTQSFQTGQ-HYWEVRA----SDHSITLGVTYPELPRRKLGTHTDNIGRGPYSWGLCIQEDSI 429

  Fly   135 QSWGFSYSGRIQHCGELLPYGQKFSQGCLIGVCLDRTRGHLEFYLNRRSLGVAYTNVPTDPDVKI 199
            |:|....:.|:...|         ..|.|:||.|:.|.|.|.||                     
  Rat   430 QAWHNGRAQRLSRAG---------VSGGLLGVDLNLTSGCLTFY--------------------- 464

  Fly   200 YPMVCSTAAKSVIRLINCTSQPVTLQLRSFQALSRQPL 237
                              :.:|.|..|.:|.|:..:||
  Rat   465 ------------------SLEPHTQPLHTFYAVFSRPL 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10516NP_648819.2 SPRY_SOCS3 51..233 CDD:293936 31/162 (19%)
Trim65NP_001129186.1 RING_Ubox 7..61 CDD:473075
Bbox_SF 89..130 CDD:469587
SPRY_PRY_TRIM65 319..500 CDD:293953 33/168 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.