DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10516 and FBXO45

DIOPT Version :9

Sequence 1:NP_648819.2 Gene:CG10516 / 39738 FlyBaseID:FBgn0036549 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001099043.1 Gene:FBXO45 / 200933 HGNCID:29148 Length:286 Species:Homo sapiens


Alignment Length:223 Identity:53/223 - (23%)
Similarity:81/223 - (36%) Gaps:56/223 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RCQCGEDESGNVNAWRWHATDESDAVVTDRDIIFH-PTY----------------SQGTAIVRGE 84
            ||..|::   |...||..............||:.: |:|                |:...|.:..
Human    68 RCLHGDE---NSEVWRSLCARSLAEEALRTDILCNLPSYKAKIRAFQHAFSTNDCSRNVYIKKNG 129

  Fly    85 QALKTNMV-----------------HFWEMRVITTLAGTDVMFGIGTESVNL---GQFKFHFVSA 129
            ..|..|.:                 |.||:.....| ||..:.||.|:...:   |     :|:.
Human   130 FTLHRNPIAQSTDGARTKIGFSEGRHAWEVWWEGPL-GTVAVIGIATKRAPMQCQG-----YVAL 188

  Fly   130 LGTNAQSWGFS-YSGRIQHCGEL---LPY---GQKFSQGCLIGVCLDRTRGHLEFYLNRRSLGVA 187
            ||::.||||:: ....:.|.||:   .|.   ..|:..|..|.|.||.....|.|......||||
Human   189 LGSDDQSWGWNLVDNNLLHNGEVNGSFPQCNNAPKYQIGERIRVILDMEDKTLAFERGYEFLGVA 253

  Fly   188 YTNVPTDPDVKIYPMVCSTAAKSVIRLI 215
            :..:   |.|.:||.|.:....:.:.|:
Human   254 FRGL---PKVCLYPAVSAVYGNTEVTLV 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10516NP_648819.2 SPRY_SOCS3 51..233 CDD:293936 49/209 (23%)
FBXO45NP_001099043.1 F-box-like 38..83 CDD:372399 6/17 (35%)
SPRY_Fbox 112..286 CDD:293964 43/176 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3953
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.