DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10516 and fbxo45

DIOPT Version :9

Sequence 1:NP_648819.2 Gene:CG10516 / 39738 FlyBaseID:FBgn0036549 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_012825639.1 Gene:fbxo45 / 100216147 XenbaseID:XB-GENE-972343 Length:282 Species:Xenopus tropicalis


Alignment Length:242 Identity:57/242 - (23%)
Similarity:88/242 - (36%) Gaps:74/242 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IPDL----------VRCQCGEDESGNVNAWRWHATDESDAVVTDR----DIIFH-PTY------- 74
            :|||          .||..|::   |...||    .....:|::.    ||:.: |||       
 Frog    49 LPDLRSCGLVCKHWYRCLHGDE---NSEVWR----SLCGRIVSEEALRTDILCNLPTYKAKMRAF 106

  Fly    75 ---------SQGTAIVRGEQALKTNMV-----------------HFWEMRVITTLAGTDVMFGIG 113
                     |:...|.:....|..|.:                 |.||:.....| ||..:.||.
 Frog   107 QHGFSSSDCSRNVYIKKNGFTLHRNPIAQSTDGARTKIGFSEGRHAWEVWWEGPL-GTVAVIGIA 170

  Fly   114 TESVNL---GQFKFHFVSALGTNAQSWGFS-YSGRIQHCGEL---LPY---GQKFSQGCLIGVCL 168
            |:...:   |     :|:.||::.||||:: ....:.|.||:   .|.   ..|:..|..|.|.|
 Frog   171 TKRAPMQCQG-----YVALLGSDDQSWGWNLVDNNLLHNGEVNGSFPQCNNAPKYQIGERIRVIL 230

  Fly   169 DRTRGHLEFYLNRRSLGVAYTNVPTDPDVKIYPMVCSTAAKSVIRLI 215
            |.....|.|......||||:..:   |...:||.|.:....:.:.|:
 Frog   231 DMEDKTLAFERGYEFLGVAFRGL---PKTCLYPAVSAVYGNTEVTLV 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10516NP_648819.2 SPRY_SOCS3 51..233 CDD:293936 50/213 (23%)
fbxo45XP_012825639.1 F-box-like 34..79 CDD:372399 9/36 (25%)
SPRY_Fbox 108..282 CDD:293964 42/176 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.