DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10516 and spsb3b

DIOPT Version :9

Sequence 1:NP_648819.2 Gene:CG10516 / 39738 FlyBaseID:FBgn0036549 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_021325917.1 Gene:spsb3b / 100005459 ZFINID:ZDB-GENE-121226-2 Length:334 Species:Danio rerio


Alignment Length:213 Identity:86/213 - (40%)
Similarity:116/213 - (54%) Gaps:16/213 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LPPYQEACNPGFCDCPFPNSIEVTNHKGHIPDLVRCQCGEDESGNVNAWRWHATDESDAV---VT 64
            :||........||.|  |...|:::.....|..:.|.|||:|.|  ..|.|...|:|.:|   ..
Zfish   115 MPPVVPVTGESFCQC--PAQTELSSDAQISPYTLSCTCGEEEQG--CDWVWDEEDKSSSVSLSCW 175

  Fly    65 DRDIIFHPTYSQGTAIVRGEQALKTNMVHFWEMRVITTLAGTDVMFGIGTESVNLGQFKFHFVSA 129
            :|.:.||..||.|||.:||.:||.... ||||:::.:.:.|||:|.||||..|||.|||..|.|.
Zfish   176 NRTVSFHSEYSCGTAAIRGSKALSDGQ-HFWEIKMTSPVYGTDMMVGIGTSEVNLDQFKHSFCSL 239

  Fly   130 LGTNAQSWGFSYSGRIQHCGELLPYGQKFSQGCLIGVCLDRTRGHLEFYLNRRSLGVAYTN---- 190
            |||:..|||.||:|.:.|.|..:.:..:|.||.:|||.||...|.|.||.|||.:|  .||    
Zfish   240 LGTDEDSWGLSYTGHLHHKGSKVNFSSRFGQGSIIGVHLDGWHGTLSFYKNRRCIG--KTNHKAN 302

  Fly   191 -VPT-DPDVKIYPMVCST 206
             :|: |..::|.|..|.|
Zfish   303 YLPSCDILLQISPKCCLT 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10516NP_648819.2 SPRY_SOCS3 51..233 CDD:293936 72/165 (44%)
spsb3bXP_021325917.1 SPRY_SOCS3 158..>295 CDD:293936 63/137 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 114 1.000 Domainoid score I6036
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4259
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1269591at2759
OrthoFinder 1 1.000 - - FOG0007402
OrthoInspector 1 1.000 - - otm26534
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12245
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5528
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.