DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Brr2 and Y54E2A.5

DIOPT Version :10

Sequence 1:NP_648818.3 Gene:Brr2 / 39737 FlyBaseID:FBgn0263599 Length:2142 Species:Drosophila melanogaster
Sequence 2:NP_497061.1 Gene:Y54E2A.5 / 175134 WormBaseID:WBGene00013190 Length:237 Species:Caenorhabditis elegans


Alignment Length:52 Identity:14/52 - (26%)
Similarity:21/52 - (40%) Gaps:16/52 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  1262 LPPQYFLRIVS----DRW----------IGAETQLPVSFRHLILPEKNMPPT 1299
            :||:|...:.|    |.|          ||.:|...|:|:..:  |...|.|
 Worm   120 VPPKYMAEVYSFIEEDEWEEKLQKVRNAIGCDTSAAVNFQEFV--EIKPPKT 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Brr2NP_648818.3 Helicase_PWI 259..368 CDD:436309
DEXHc_Brr2_1 464..677 CDD:350777
BRR2 476..1020 CDD:440817
Sec63 982..1285 CDD:460740 9/36 (25%)
BRR2 1309..1848 CDD:440817
DEXHc_Brr2_2 1325..1514 CDD:350779
Sec63 1811..2127 CDD:460740
Y54E2A.5NP_497061.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.