DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elgi and AT1G66620

DIOPT Version :9

Sequence 1:NP_001261904.1 Gene:elgi / 39735 FlyBaseID:FBgn0283649 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_176835.1 Gene:AT1G66620 / 842980 AraportID:AT1G66620 Length:313 Species:Arabidopsis thaliana


Alignment Length:109 Identity:32/109 - (29%)
Similarity:46/109 - (42%) Gaps:25/109 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LTCPICSGVLEDPLQAVMCE--HAFCRGCINEWLTRQPTCPVDRNSLTTANLRAVPRILRNLLSR 78
            |.||||...|..|:  ..|:  |..|..|..:...:.|:|     :|...|.|:  ||:..::..
plant    42 LDCPICCHALTSPI--FQCDNGHIACSSCCTKLRNKCPSC-----ALPIGNFRS--RIMERVVEA 97

  Fly    79 LSITCDNAPYGCTAVLKLDAYNSHLDECIHNPKRPFPCEKGCGF 122
            :.:||.|..:|||...      |:..|.||        ||.|.|
plant    98 VMVTCPNVKHGCTEKF------SYGKELIH--------EKDCRF 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elgiNP_001261904.1 RING 17..55 CDD:238093 12/39 (31%)
Sina 83..>157 CDD:302762 13/40 (33%)
USP8_interact 137..315 CDD:286082
AT1G66620NP_176835.1 Sina 87..>163 CDD:302762 17/57 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.