DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elgi and AT5G37910

DIOPT Version :9

Sequence 1:NP_001261904.1 Gene:elgi / 39735 FlyBaseID:FBgn0283649 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_198607.1 Gene:AT5G37910 / 833770 AraportID:AT5G37910 Length:276 Species:Arabidopsis thaliana


Alignment Length:94 Identity:27/94 - (28%)
Similarity:41/94 - (43%) Gaps:11/94 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LTCPICSGVLEDPLQAVMCE--HAFCRGCINEWLTRQPTCPVDRNSLTTANLRAVPRILRNLLSR 78
            |.||||...|..|:  ..|:  |..|..|..:...:.|.|     :|...:.|:  |.:.::|..
plant    36 LDCPICCEALTSPI--FQCDNGHLACGSCCPKLSNKCPAC-----TLPVGHSRS--RAMESVLES 91

  Fly    79 LSITCDNAPYGCTAVLKLDAYNSHLDECI 107
            :.|.|.|..:|||........::|..|||
plant    92 ILIPCPNVRFGCTKSFFYGKESAHEKECI 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elgiNP_001261904.1 RING 17..55 CDD:238093 12/39 (31%)
Sina 83..>157 CDD:302762 9/25 (36%)
USP8_interact 137..315 CDD:286082
AT5G37910NP_198607.1 Sina 81..>233 CDD:302762 13/42 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.