Sequence 1: | NP_001261904.1 | Gene: | elgi / 39735 | FlyBaseID: | FBgn0283649 | Length: | 315 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_004611.1 | Gene: | TRAF6 / 7189 | HGNCID: | 12036 | Length: | 522 | Species: | Homo sapiens |
Alignment Length: | 326 | Identity: | 59/326 - (18%) |
---|---|---|---|
Similarity: | 98/326 - (30%) | Gaps: | 132/326 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 GYDVNRFQGEVDEELTCPICSGVLEDPLQAVMCEHAFCRGCINEWL-TRQPTCPVDRNSLTTANL 65
Fly 66 RAVPRILRNLLS----------------------------------------------------- 77
Fly 78 -RLSITCDNAPYG----------------------CTAVLKLDAYNSHLD-ECIHNPKRPFPC-- 116
Fly 117 -EKGCGFDIPKDELKDH-----------------------------------NCVRELRTLIVKQ 145
Fly 146 TEKMGELKSELTDQQLTINELKRELQLFKDFMRAM-----------RVSNPAMRAIADQMERDEV 199
Fly 200 I 200 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
elgi | NP_001261904.1 | RING | 17..55 | CDD:238093 | 13/38 (34%) |
Sina | 83..>157 | CDD:302762 | 21/134 (16%) | ||
USP8_interact | 137..315 | CDD:286082 | 16/75 (21%) | ||
TRAF6 | NP_004611.1 | Interaction with TAX1BP1. /evidence=ECO:0000269|PubMed:10920205 | 1..354 | 54/303 (18%) | |
RING | 69..107 | CDD:238093 | 13/38 (34%) | ||
zf-TRAF | 204..261 | CDD:280357 | 12/59 (20%) | ||
MATH_TRAF6 | 351..500 | CDD:239745 | 5/25 (20%) | ||
Interaction with TANK. /evidence=ECO:0000269|PubMed:25861989 | 355..522 | 5/21 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0297 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D918518at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |