DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elgi and TRAF6

DIOPT Version :9

Sequence 1:NP_001261904.1 Gene:elgi / 39735 FlyBaseID:FBgn0283649 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_004611.1 Gene:TRAF6 / 7189 HGNCID:12036 Length:522 Species:Homo sapiens


Alignment Length:326 Identity:59/326 - (18%)
Similarity:98/326 - (30%) Gaps:132/326 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GYDVNRFQGEVDEELTCPICSGVLEDPLQAVMCEHAFCRGCINEWL-TRQPTCPVDRNSLTTANL 65
            |||| .|...::.:..||||...|.:.:| ..|.|.||:.||.:.: .....||||...|....|
Human    55 GYDV-EFDPPLESKYECPICLMALREAVQ-TPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQL 117

  Fly    66 RAVPRILRNLLS----------------------------------------------------- 77
            .......|.:||                                                     
Human   118 FPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILKDC 182

  Fly    78 -RLSITCDNAPYG----------------------CTAVLKLDAYNSHLD-ECIHNPKRPFPC-- 116
             |..::|||....                      |..:|..:...:|.| :|   |..|.||  
Human   183 PRRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDC---PTAPIPCTF 244

  Fly   117 -EKGCGFDIPKDELKDH-----------------------------------NCVRELRTLIVKQ 145
             ..||...:.::.|..|                                   ..:.:|...:|:|
Human   245 STFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIHQLEGRLVRQ 309

  Fly   146 TEKMGELKSELTDQQLTINELKRELQLFKDFMRAM-----------RVSNPAMRAIADQMERDEV 199
            ..::.||.:::..|.:.::||||.::..:|.:..:           ::.|..|.....:.|:..|
Human   310 DHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHLKCQEEEKPVV 374

  Fly   200 I 200
            |
Human   375 I 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elgiNP_001261904.1 RING 17..55 CDD:238093 13/38 (34%)
Sina 83..>157 CDD:302762 21/134 (16%)
USP8_interact 137..315 CDD:286082 16/75 (21%)
TRAF6NP_004611.1 Interaction with TAX1BP1. /evidence=ECO:0000269|PubMed:10920205 1..354 54/303 (18%)
RING 69..107 CDD:238093 13/38 (34%)
zf-TRAF 204..261 CDD:280357 12/59 (20%)
MATH_TRAF6 351..500 CDD:239745 5/25 (20%)
Interaction with TANK. /evidence=ECO:0000269|PubMed:25861989 355..522 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.