DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elgi and TRAF2

DIOPT Version :9

Sequence 1:NP_001261904.1 Gene:elgi / 39735 FlyBaseID:FBgn0283649 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_066961.2 Gene:TRAF2 / 7186 HGNCID:12032 Length:501 Species:Homo sapiens


Alignment Length:305 Identity:58/305 - (19%)
Similarity:104/305 - (34%) Gaps:105/305 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GYDVNRFQGEVDEELTCPICSGVLEDPLQAVMCEHAF---------------CRGCINEWLTRQP 51
            |:.......:::.:..|..|..||..|.|| .|.|.:               |..|::|.:..:.
Human    18 GFSKTLLGTKLEAKYLCSACRNVLRRPFQA-QCGHRYCSFCLASILSSGPQNCAACVHEGIYEEG 81

  Fly    52 TCPVDRNSLTTAN-----LRAVPRI-----------LRNLLS----RLSITCDNAPYGCTAVLKL 96
            ...::.:|....|     :.::|.:           |:...|    |..:.....| .|..:::|
Human    82 ISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKEYESCHEGRCPLMLTECP-ACKGLVRL 145

  Fly    97 DAYNSHLD-EC--------------------IHN---PKRPFPCEKGCG-FDIPKDELKDH---- 132
            .....||: ||                    .|:   ||.|..|: ||| ..||:::.:||    
Human   146 GEKERHLEHECPERSLSCRHCRAPCCGADVKAHHEVCPKFPLTCD-GCGKKKIPREKFQDHVKTC 209

  Fly   133 ------------NC-------------VRELRTLIVKQTEKMGELKSELTDQQLTINE------- 165
                        .|             |:.||..:......:.|.|..|.||....:|       
Human   210 GKCRVPCRFHAIGCLETVEGEKQQEHEVQWLREHLAMLLSSVLEAKPLLGDQSHAGSELLQRCES 274

  Fly   166 LKRELQLFKDFMRAM--RVSNPAMRAIA----DQMERDEVIRWSS 204
            |:::...|::.:..:  .|...||.|.|    .::::|::...||
Human   275 LEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSS 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elgiNP_001261904.1 RING 17..55 CDD:238093 12/52 (23%)
Sina 83..>157 CDD:302762 25/127 (20%)
USP8_interact 137..315 CDD:286082 18/81 (22%)
TRAF2NP_066961.2 RAD18 28..>157 CDD:333230 24/130 (18%)
RING-HC_TRAF2 32..73 CDD:319553 10/41 (24%)
RING-HC finger (C3HC4-type) 34..72 CDD:319553 10/38 (26%)
zf-TRAF 178..235 CDD:280357 13/57 (23%)
TRAF_BIRC3_bd 267..329 CDD:318808 11/53 (21%)
Important for interaction with BIRC2 and BIRC3. /evidence=ECO:0000250 283..293 0/9 (0%)
MATH_TRAF2 334..497 CDD:239747
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.