DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elgi and TRAF1

DIOPT Version :9

Sequence 1:NP_001261904.1 Gene:elgi / 39735 FlyBaseID:FBgn0283649 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001177874.1 Gene:TRAF1 / 7185 HGNCID:12031 Length:416 Species:Homo sapiens


Alignment Length:345 Identity:66/345 - (19%)
Similarity:122/345 - (35%) Gaps:93/345 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DVNRFQGEVDEELTCP--ICSGVLEDPLQ-AVMCEHAFCRGCINEWLTRQP------TCP----- 54
            |.|.|      ...||  :|    :||.: ..:|    |.||::|    .|      .||     
Human    14 DENEF------PFGCPPTVC----QDPKEPRALC----CAGCLSE----NPRNGEDQICPKCRGE 60

  Fly    55 ----VDRNSLTTANLRAVPRILRNLLSRLSITCDNAPYGCT--------AVLKLDAYNSHLDECI 107
                :...|......:|.|.:     :...|.|..|..||:        ...::.:..|||:..:
Human    61 DLQSISPGSRLRTQEKAHPEV-----AEAGIGCPFAGVGCSFKGSPQSVQEHEVTSQTSHLNLLL 120

  Fly   108 HNPKRPFPCEKGCGFDIPKDELKDHNCVRELRTLIVKQTEKMGELKSEL-------TDQQLTIN- 164
            ...|: :....|||.:.....|:.:....:|:..:    |..|:|:.:.       :.::|.:. 
Human   121 GFMKQ-WKARLGCGLESGPMALEQNLSDLQLQAAV----EVAGDLEVDCYRAPCSESQEELALQH 180

  Fly   165 --------ELKRELQLFKDFMRAMRVSNPAMR-AIA-----DQMERDEVIRWSSTLPRARVTRWG 215
                    ||:.:|::|::.:..:.....|.. |:|     .|::|:.::....     ||....
Human   181 FMKEKLLAELEGKLRVFENIVAVLNKEVEASHLALATSIHQSQLDRERILSLEQ-----RVVELQ 240

  Fly   216 GMISTPDDAL-----QLMIKRALSESGCPPHILDSLMEFCHERRWPRGLSSLETRQTNRRIYDNY 275
            ..::..|.||     .|.:....|..|.....:.::...|||....|.:|.........: |...
Human   241 QTLAQKDQALGKLEQSLRLMEEASFDGTFLWKITNVTRRCHESACGRTVSLFSPAFYTAK-YGYK 304

  Fly   276 VCRRI------PGKQAVLVL 289
            :|.|:      .||:..|.|
Human   305 LCLRLYLNGDGTGKRTHLSL 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elgiNP_001261904.1 RING 17..55 CDD:238093 13/55 (24%)
Sina 83..>157 CDD:302762 16/88 (18%)
USP8_interact 137..315 CDD:286082 34/186 (18%)
TRAF1NP_001177874.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 4/15 (27%)
SMC_N <140..>263 CDD:330553 21/131 (16%)
TRAF_BIRC3_bd 184..244 CDD:318808 11/64 (17%)
MATH_TRAF1 267..413 CDD:239748 13/59 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.