DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elgi and Traf1

DIOPT Version :9

Sequence 1:NP_001261904.1 Gene:elgi / 39735 FlyBaseID:FBgn0283649 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001258169.1 Gene:Traf1 / 687813 RGDID:1596290 Length:409 Species:Rattus norvegicus


Alignment Length:351 Identity:72/351 - (20%)
Similarity:122/351 - (34%) Gaps:106/351 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DVNRFQGEVDEELTCPICSGVLEDPLQ-AVMCEHAFCRGCINEWLTRQ-----PTC------PVD 56
            |.|.||      ..||....  :||.: ..:|    |..|::|.|...     |.|      ||.
  Rat     8 DENEFQ------FGCPPAPS--QDPSEPRALC----CTACLSENLRDDEERICPKCRADGLQPVS 60

  Fly    57 RNSLTTANLRAVPRILRNLLSRLSITCDNAPYGCT------AVLKLDA--YNSH-------LDEC 106
            ..||.|.. :.:|.:     :...|.|..|..||:      :|.:.:|  .:||       |.|.
  Rat    61 PGSLLTQE-KVLPDV-----AEAGIVCPFAGVGCSFKGSPQSVQEHEATSQSSHLYLLLGVLKEW 119

  Fly   107 IHNP-----KRPFPCEKGCGFDIPKDELKDHNCVRELRTLIVKQTEKMGEL------------KS 154
            ..:|     ..|...|:.               :.||:  :.:..|..|:|            :.
  Rat   120 KSSPGPNLGSAPMALEQN---------------LSELQ--LQEAVEVTGDLEVDCYRAPCCESQE 167

  Fly   155 ELTDQQL----TINELKRELQLFKDFM----RAMRVSNPAMRAI--ADQMERDEVIRWSSTLPRA 209
            ||..|.|    .:.:|:.:|::|.:.:    :.:..|:.|:.|.  ..|::|:.|:....     
  Rat   168 ELALQHLLKEKLLAQLEEKLRVFANIVAVLNKEVEASHLALAASIHQSQLDREHVLNLEQ----- 227

  Fly   210 RVTRWGGMISTPDDAL-----QLMIKRALSESGCPPHILDSLMEFCHERRWPRGLSSLETRQTNR 269
            ||......::..|..|     .|.:....|..|.....:.::.:.|||....|.:|.........
  Rat   228 RVVELQQTLAQKDQVLGKLEHSLRLMEEASFDGTFLWKITNVTKRCHESVCGRTVSLFSPAFYTA 292

  Fly   270 RIYDNYVCRRI------PGKQAVLVL 289
            : |...:|.|:      .||:..|.|
  Rat   293 K-YGYKLCLRLYLNGDGSGKKTHLSL 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elgiNP_001261904.1 RING 17..55 CDD:238093 11/49 (22%)
Sina 83..>157 CDD:302762 19/105 (18%)
USP8_interact 137..315 CDD:286082 37/186 (20%)
Traf1NP_001258169.1 TRAF_BIRC3_bd 180..237 CDD:406958 11/61 (18%)
MATH_TRAF1 260..406 CDD:239748 13/59 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.