DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elgi and lnx2b

DIOPT Version :9

Sequence 1:NP_001261904.1 Gene:elgi / 39735 FlyBaseID:FBgn0283649 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_998105.2 Gene:lnx2b / 564464 ZFINID:ZDB-GENE-040426-2500 Length:678 Species:Danio rerio


Alignment Length:287 Identity:72/287 - (25%)
Similarity:110/287 - (38%) Gaps:74/287 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GYDVNRF--QGEVDEELTCPICSGVLEDPLQAVMCEHAFCRGCINEWLTRQPTCPVDRNSLTTAN 64
            |.|.:.|  |.|||:||.|.||...|..|:. ..|.|.:|..|::.:|..|..|||||..:....
Zfish    28 GQDSHLFEYQDEVDDELVCHICLQPLLQPMD-TPCGHTYCFQCLSNFLHDQDFCPVDRQRIQLQQ 91

  Fly    65 LRAVPRILRNLLSRLSITCDNAPYGCTAVLKLDAYNSHLDECIHNPKRPFPCEKGCGFDIPKDEL 129
            .||...::||||.:|::.|                             ||..|  |...:.:.||
Zfish    92 CRASSLLVRNLLDKLAVLC-----------------------------PFRSE--CELSMQRCEL 125

  Fly   130 KDH---NC--VRELRTLIV-KQTEKMGELKSELTDQQLTINELKRELQLFKDFMRAMRVSNPAMR 188
            :.|   .|  .:.||.... |:.....|||...:|..|.      :.:..:...|..::|.|:..
Zfish   126 QPHLHNRCPAFKRLREEAERKKRPSWNELKGSKSDGDLA------DAKSAQTIGRTAQLSAPSEP 184

  Fly   189 AIA----DQMERDEVIRWSSTLPRARVT-------------RWGGMISTP--DDALQLMIKRAL- 233
            .:.    ::.|.|..:| .|.:..|.|.             |..|...||  :..:|.:::.:| 
Zfish   185 GLVNPAFEEGEDDTPLR-CSLVAEATVVELFREDPGEDLGLRIVGGKDTPLGNIVIQEIVRDSLV 248

  Fly   234 -SESGCPP--HILD----SLMEFCHER 253
             .:....|  |||:    ||....|.|
Zfish   249 ARDGKLAPGDHILEVNDVSLASISHSR 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elgiNP_001261904.1 RING 17..55 CDD:238093 12/37 (32%)
Sina 83..>157 CDD:302762 15/79 (19%)
USP8_interact 137..315 CDD:286082 31/145 (21%)
lnx2bNP_998105.2 RING 46..82 CDD:214546 12/36 (33%)
PDZ_signaling 210..291 CDD:238492 15/66 (23%)
PDZ_signaling 325..406 CDD:238492
PDZ_signaling 451..537 CDD:238492
PDZ_signaling 587..671 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.