DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elgi and traf7

DIOPT Version :9

Sequence 1:NP_001261904.1 Gene:elgi / 39735 FlyBaseID:FBgn0283649 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001073654.1 Gene:traf7 / 563746 ZFINID:ZDB-GENE-070112-2212 Length:639 Species:Danio rerio


Alignment Length:249 Identity:54/249 - (21%)
Similarity:86/249 - (34%) Gaps:87/249 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FQGEVDEELTCPICSGVLEDPLQAVMCEHAFCRGCINEWLTRQPTCPVDRNSLTTA--------- 63
            |..:...:|.|.:|..|.:||: ...|.|.|||.|.   ||.: .||||.:.||..         
Zfish    90 FAEQPSVKLCCQLCCSVFKDPV-ITTCGHTFCRRCA---LTSE-KCPVDNSKLTVVVNNIAVAEQ 149

  Fly    64 -------------------------------------------------------NLRAVPRILR 73
                                                                   |....|.:..
Zfish   150 IGELFIHCKYGCRPAASGKSGAYEVDPLGCPFTIKLSTRKDHEVSCDYRPVRCPNNPNCPPLLTM 214

  Fly    74 NLLSRLS----ITCDNAPYGCTAVLKLDAYNSHLDECIHNPKRPFPCEKGCGFDIPKDEL--KDH 132
            ||.:.|.    |.|.::.||||.:...|.|.:||:.|.....:.|..:....|...:..|  ||.
Zfish   215 NLEAHLKECEHIKCPHSKYGCTFIGNQDTYETHLEVCKFEGLKEFLQQTDDRFHEMQVTLAQKDQ 279

  Fly   133 NCVRELRTLIVKQTEKMG------ELKSELTDQQLT-----INELKRELQLFKD 175
            : :..||:::.|.:||:.      |||.::.|:..:     :.|.:|:..:..|
Zfish   280 D-ISFLRSMLGKLSEKLDQLEKNLELKFDVLDENQSKLSEDLMEFRRDASMLND 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elgiNP_001261904.1 RING 17..55 CDD:238093 14/37 (38%)
Sina 83..>157 CDD:302762 23/81 (28%)
USP8_interact 137..315 CDD:286082 12/50 (24%)
traf7NP_001073654.1 RING 100..132 CDD:214546 14/36 (39%)
Sina 141..>249 CDD:302762 14/107 (13%)
Snapin_Pallidin 260..342 CDD:291383 16/74 (22%)
WD40 <349..637 CDD:225201
WD40 357..637 CDD:238121
WD40 repeat 368..406 CDD:293791
WD40 repeat 412..446 CDD:293791
WD40 repeat 451..486 CDD:293791
WD40 repeat 493..525 CDD:293791
WD40 repeat 531..565 CDD:293791
WD40 repeat 573..608 CDD:293791
WD40 repeat 615..637 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.