DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elgi and traf2b

DIOPT Version :9

Sequence 1:NP_001261904.1 Gene:elgi / 39735 FlyBaseID:FBgn0283649 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_005165556.1 Gene:traf2b / 557526 ZFINID:ZDB-GENE-030131-5345 Length:532 Species:Danio rerio


Alignment Length:215 Identity:50/215 - (23%)
Similarity:75/215 - (34%) Gaps:36/215 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VDEELTCPICSGVLEDPLQAVMCEHAFCRGCINEWLTRQP----TCPVD---RNSLTTANLR-AV 68
            ::.:..|..|..:|..|.|| .|.|.||..|..:..:..|    .|..:   ....:..|:. |.
Zfish    39 MEPKYQCQQCKDILRKPFQA-QCGHRFCVFCFKQLTSSGPIPCEACRAEGIFEEETSVLNIAVAF 102

  Fly    69 P-RILRNLLSRLSITCDNAPYGCTAVLKLDAYNSHLDECIHNPKRPFPCEKGCGFDI---PKDEL 129
            | ...|..:..|...|.|.....:..|| |..|.|...|.....:   || .|...|   .||..
Zfish   103 PDNAARREIDSLPAKCPNEGCSWSGTLK-DFENQHEGRCAFERVK---CE-ACQVLILLSEKDRH 162

  Fly   130 KDHNCVRELRTL---IVKQTEKMGELKS------ELTDQQLTINELKRELQLFKDFMRAMRVSNP 185
            .:..|  |.|||   ..|.|....|:|:      :...|.....:.|...:.|::..::...|..
Zfish   163 NEREC--EARTLNCKYCKVTFNFKEIKAHDEICQKFPMQCKDCGKKKIPREKFQEHTKSCAKSKS 225

  Fly   186 A-------MRAIADQMERDE 198
            |       .||:.|..::.|
Zfish   226 ACQFREIGCRAVVDNCKQQE 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elgiNP_001261904.1 RING 17..55 CDD:238093 13/41 (32%)
Sina 83..>157 CDD:302762 23/85 (27%)
USP8_interact 137..315 CDD:286082 17/78 (22%)
traf2bXP_005165556.1 RING 44..86 CDD:238093 13/42 (31%)
zf-TRAF 189..246 CDD:280357 9/57 (16%)
TRAF_BIRC3_bd 307..359 CDD:293278
MATH_TRAF2 365..528 CDD:239747
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.