DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elgi and traf6

DIOPT Version :9

Sequence 1:NP_001261904.1 Gene:elgi / 39735 FlyBaseID:FBgn0283649 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001038217.1 Gene:traf6 / 554561 ZFINID:ZDB-GENE-030131-5735 Length:542 Species:Danio rerio


Alignment Length:254 Identity:65/254 - (25%)
Similarity:102/254 - (40%) Gaps:67/254 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GYDVNRFQGEVDEELTCPICSGVLEDPLQAVMCEHAFCRGCINEWL--TRQPTCPVDRNSLTTAN 64
            |||| .|...::.:..||||...|...:| ..|.|.||..||.:.:  |.| .||||...|....
Zfish    56 GYDV-EFDPPLESKYECPICLMGLRSAVQ-TPCGHRFCDSCIRKSIRDTGQ-KCPVDNEVLLEEQ 117

  Fly    65 LRAVPRILRNLLSRLSITCDNAPYGCTAVLKLDAYNSHLDECIHNPKRPFPCEKGCGFDIP---K 126
            |.......|.:|| |::.|.|  :||:..::|.....||.:|..   ...||.: |...:|   .
Zfish   118 LFPDNFAKREILS-LTVKCSN--FGCSEKMELRQLEKHLSQCRF---ATAPCPQ-CQESVPISHL 175

  Fly   127 DELKDHNCVRELRT---------LIVKQTE--------------KMGELKSEL-----TD----- 158
            ||.|..:|::.:.|         ..|||..              :|..::.:|     ||     
Zfish   176 DEHKSQHCLQRIMTCPDCAGSFVYAVKQNHEQFCPFANTVCEYCEMELIRDQLALHCDTDCLKAP 240

  Fly   159 -----------QQLTINELKRELQLF--------KDFMRAMRVSNPAMRAIADQMERDE 198
                       :::|.|||.:.:|.|        .:|:|:..::|..|.:.|..:..|:
Zfish   241 VACTFSTFGCREKMTRNELAQHMQEFTQMHMRYMAEFLRSQTLNNCTMPSAAAHLSSDD 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elgiNP_001261904.1 RING 17..55 CDD:238093 15/39 (38%)
Sina 83..>157 CDD:302762 22/104 (21%)
USP8_interact 137..315 CDD:286082 20/114 (18%)
traf6NP_001038217.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..54
RING 71..108 CDD:214546 15/38 (39%)
zf-TRAF 205..262 CDD:280357 8/56 (14%)
MATH_TRAF6 375..521 CDD:239745
Substrate binding. /evidence=ECO:0000250 489..496
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.