Sequence 1: | NP_001261904.1 | Gene: | elgi / 39735 | FlyBaseID: | FBgn0283649 | Length: | 315 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001038217.1 | Gene: | traf6 / 554561 | ZFINID: | ZDB-GENE-030131-5735 | Length: | 542 | Species: | Danio rerio |
Alignment Length: | 254 | Identity: | 65/254 - (25%) |
---|---|---|---|
Similarity: | 102/254 - (40%) | Gaps: | 67/254 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 GYDVNRFQGEVDEELTCPICSGVLEDPLQAVMCEHAFCRGCINEWL--TRQPTCPVDRNSLTTAN 64
Fly 65 LRAVPRILRNLLSRLSITCDNAPYGCTAVLKLDAYNSHLDECIHNPKRPFPCEKGCGFDIP---K 126
Fly 127 DELKDHNCVRELRT---------LIVKQTE--------------KMGELKSEL-----TD----- 158
Fly 159 -----------QQLTINELKRELQLF--------KDFMRAMRVSNPAMRAIADQMERDE 198 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
elgi | NP_001261904.1 | RING | 17..55 | CDD:238093 | 15/39 (38%) |
Sina | 83..>157 | CDD:302762 | 22/104 (21%) | ||
USP8_interact | 137..315 | CDD:286082 | 20/114 (18%) | ||
traf6 | NP_001038217.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 32..54 | ||
RING | 71..108 | CDD:214546 | 15/38 (39%) | ||
zf-TRAF | 205..262 | CDD:280357 | 8/56 (14%) | ||
MATH_TRAF6 | 375..521 | CDD:239745 | |||
Substrate binding. /evidence=ECO:0000250 | 489..496 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0297 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D918518at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |