DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elgi and traf6

DIOPT Version :9

Sequence 1:NP_001261904.1 Gene:elgi / 39735 FlyBaseID:FBgn0283649 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001008162.2 Gene:traf6 / 493524 XenbaseID:XB-GENE-480628 Length:558 Species:Xenopus tropicalis


Alignment Length:292 Identity:71/292 - (24%)
Similarity:116/292 - (39%) Gaps:56/292 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GYDVNRFQGEVDEELTCPICSGVLEDPLQAVMCEHAFCRGCINEWL-TRQPTCPVDRNSLTTANL 65
            |||| .|...::.:..||||...|.:.:| ..|.|.||:.||.:.: .....||||..||....|
 Frog    57 GYDV-EFDPPLESKYECPICLMALREAVQ-TPCGHRFCKACILKSIRDAGHKCPVDNESLMENQL 119

  Fly    66 RAVPRILRNLLSRLSITCDNAPYGCTAVLKLDAYNSHLDECIHNPKRPF---PCEKGCGFDIPKD 127
            .......|.:|| |.:.|.:  .|||..::|.....||..|      .|   .|.: |....||.
 Frog   120 FPDNFAKREILS-LRVKCPS--QGCTETMELRHLERHLVRC------DFAGVECSQ-CQSSFPKY 174

  Fly   128 ELKDH---NCVRELRTLIVKQTEKMGELKSELT-DQQLTINELKRE---LQLFKDFMRAMRVSNP 185
            .|:.|   .|.|  |.:..:.......|:.:|. ||...:..:..|   ..|.::.|.|....:.
 Frog   175 SLQKHKFEECPR--RQIFCENCAVAMALEDKLNHDQTCPLAYVTCEYCQTNLIREQMPAHYSMDC 237

  Fly   186 AMRAI---------ADQMERDEVIRWSSTLPRARVTRWGGMISTPDDALQLMIK--RALSESGCP 239
            .|..|         .::|:|:::.|......:|.              :::|.:  |:.|.|..|
 Frog   238 TMAPIPCMYYEFGCTEKMQRNDLARHLQEFTQAH--------------MRMMAQTLRSFSSSVTP 288

  Fly   240 -PHILDSLMEFCHERRW---PRGLSSLETRQT 267
             .|:.|  :.||...::   |..::::.:..|
 Frog   289 TSHMPD--ISFCDPSQFEPAPPSVATVHSTHT 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elgiNP_001261904.1 RING 17..55 CDD:238093 13/38 (34%)
Sina 83..>157 CDD:302762 19/79 (24%)
USP8_interact 137..315 CDD:286082 26/150 (17%)
traf6NP_001008162.2 mRING-HC-C3HC3D_TRAF6 69..126 CDD:319557 19/57 (33%)
modified RING-HC finger (C3HC3D-type) 72..110 CDD:319557 14/38 (37%)
PLN03086 <134..220 CDD:178635 23/96 (24%)
zf-TRAF 206..263 CDD:280357 10/56 (18%)
Smc <322..>384 CDD:224117
MATH_TRAF6 387..536 CDD:239745
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.