DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elgi and traf4a

DIOPT Version :9

Sequence 1:NP_001261904.1 Gene:elgi / 39735 FlyBaseID:FBgn0283649 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_991325.1 Gene:traf4a / 404045 ZFINID:ZDB-GENE-040308-1 Length:470 Species:Danio rerio


Alignment Length:132 Identity:37/132 - (28%)
Similarity:61/132 - (46%) Gaps:6/132 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GYDVNRFQGEVDEELTCPICSGVLEDPLQAVMCEHAFCRGCINEWLTRQP-TCPVDRNSLTTANL 65
            |:|. :|..:......||:||..:.:|:|...|.|.||..|:.|:|:... .||.|:..|..|.:
Zfish     3 GFDY-KFLEKPKRRFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKI 66

  Fly    66 RAVPRILRNLLSRLSITCDNAPYGCTAVLKLDAYNSHLDECIHNPKRPFPCEKGCGFDIPKDELK 130
            ...|.:.:.:|: |.|.|.::..||....::....||...|..|   ..||...|...:.:.:|.
Zfish    67 YPDPELEQQILA-LPIRCIHSEEGCRWTGQMKQLQSHFSTCAFN---VIPCPNRCSVKLTRRDLP 127

  Fly   131 DH 132
            :|
Zfish   128 EH 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elgiNP_001261904.1 RING 17..55 CDD:238093 14/38 (37%)
Sina 83..>157 CDD:302762 12/50 (24%)
USP8_interact 137..315 CDD:286082
traf4aNP_991325.1 RING 17..55 CDD:238093 13/37 (35%)
zf-TRAF 102..156 CDD:280357 8/31 (26%)
zf-TRAF 156..210 CDD:280357
zf-TRAF 210..269 CDD:280357
MATH_TRAF4 308..463 CDD:239750
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.