DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elgi and traf4b

DIOPT Version :9

Sequence 1:NP_001261904.1 Gene:elgi / 39735 FlyBaseID:FBgn0283649 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_997982.1 Gene:traf4b / 404035 ZFINID:ZDB-GENE-040305-2 Length:478 Species:Danio rerio


Alignment Length:141 Identity:42/141 - (29%)
Similarity:65/141 - (46%) Gaps:13/141 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GYDVNRFQGEVDEELTCPICSGVLEDPLQAVMCEHAFCRGCINEWLTRQP-TCPVDRNSLTTANL 65
            |.|: :|......:..||:|...:.:|:|...|.|.||..|:.|:|:... |||.|:..|..|.:
Zfish     3 GLDL-KFLERPRRKFYCPLCEKPMREPVQVSTCGHRFCDTCLQEYLSEGVFTCPEDQLPLDYAKI 66

  Fly    66 RAVPRILRNLLSRLSITCDNAPYGC--TAVLKLDAYNSHLDECIHNPKRPFPCEKGCGFDIPKDE 128
            .....:.:.:|| |.|.|.::..||  ||..||  ..:||..|..|   ...|...|...:.:.|
Zfish    67 FPDLELEQQILS-LPIRCIHSEEGCRWTAQNKL--LQAHLSVCEFN---VVSCPNRCSVKLLRRE 125

  Fly   129 LKD---HNCVR 136
            |.:   |:|.:
Zfish   126 LPEHLQHDCAK 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elgiNP_001261904.1 RING 17..55 CDD:238093 14/38 (37%)
Sina 83..>157 CDD:302762 17/59 (29%)
USP8_interact 137..315 CDD:286082 42/141 (30%)
traf4bNP_997982.1 RING 18..55 CDD:238093 13/36 (36%)
zf-TRAF 102..156 CDD:280357 10/38 (26%)
zf-TRAF 156..210 CDD:280357
zf-TRAF 210..269 CDD:280357
MATH_TRAF4 308..471 CDD:239750
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.