DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elgi and Traf-like

DIOPT Version :10

Sequence 1:NP_648816.1 Gene:elgi / 39735 FlyBaseID:FBgn0283649 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_727976.1 Gene:Traf-like / 32611 FlyBaseID:FBgn0030748 Length:474 Species:Drosophila melanogaster


Alignment Length:109 Identity:20/109 - (18%)
Similarity:38/109 - (34%) Gaps:23/109 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DFLLKLQGHDMLGYIILELIHRE-----------DVGEVHEEDDGME--------DITKKYHNEV 47
            |.::.|.|  ..|.:.|:|.|.:           ..|::...|.|:.        |:.:...|..
  Fly   237 DGIVSLDG--TKGSVALQLYHNKFETSFVLNKTLGFGKLEVFDGGVTKTNLITTYDVNRSELNLP 299

  Fly    48 GEVVQGVPQLRRSGRQISQSRYLEDYVMQSETTYGLFHQAYVKS 91
            .|....:..|..:|...|.:....|......|::|  .:.::.|
  Fly   300 QEFFGRLTTLVFTGETASLTFTRRDDAFDETTSFG--RKGFISS 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elgiNP_648816.1 mRING-HC-C3HC3D_Nrdp1 15..57 CDD:438296 9/60 (15%)
USP8_interact 137..315 CDD:430333
Traf-likeNP_727976.1 SMC_prok_B <131..>336 CDD:274008 19/102 (19%)
MATH_TRAF_C 334..473 CDD:238168 2/10 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.