DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elgi and Traf2

DIOPT Version :9

Sequence 1:NP_001261904.1 Gene:elgi / 39735 FlyBaseID:FBgn0283649 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001101285.1 Gene:Traf2 / 311786 RGDID:1310457 Length:497 Species:Rattus norvegicus


Alignment Length:299 Identity:53/299 - (17%)
Similarity:93/299 - (31%) Gaps:107/299 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GYDVNRFQGEVDEELTCPICSGVLEDPLQAVMCEHAFCRGCINEWLTRQP-TCPV--------DR 57
            |:........::.:..|..|..:|..|.|| .|.|.:|..|:...|:..| .|..        :.
  Rat    18 GFSKTLLGTRLEAKYLCSACRNILRRPFQA-QCGHRYCSFCLTSILSSGPQNCAACVHEGLYEEG 81

  Fly    58 NSLTTANLRAVPRILRNLLSRLSITCDN-------------------APY------GCTAVLKLD 97
            .|:..::........|..:..|...|.|                   .|:      .|..:::|.
  Rat    82 ISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLS 146

  Fly    98 AYNSHLDE---------------CIHN---------PKRPFPCEKGCGFDIPKDELKDH--NCVR 136
            ....|.::               |.|.         ||.|..|: |||..|.:::|:||  .|.:
  Rat   147 EKKHHTEQECPKRSLSCQHCRAPCSHADLELHYEVCPKFPLTCD-GCGKKISQEKLQDHVRTCSK 210

  Fly   137 ------------------------ELRTLIVKQTEKMGELKSELTDQQLTINELKREL------- 170
                                    ||:.|    .|.:..|.|...:.|.:.|::..||       
  Rat   211 CRVLCRFHAIGCSELVETEDLQDHELQRL----REHLALLLSSFLESQASQNQVGPELLQRCQIL 271

  Fly   171 -QLFKDFMRAMRVSNPAMRAIA---------DQMERDEV 199
             |....|...:.|.|..:..:|         .::::|::
  Rat   272 EQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKI 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elgiNP_001261904.1 RING 17..55 CDD:238093 13/38 (34%)
Sina 83..>157 CDD:302762 26/148 (18%)
USP8_interact 137..315 CDD:286082 16/80 (20%)
Traf2NP_001101285.1 RING-HC_TRAF2 32..73 CDD:319553 13/41 (32%)
zf-TRAF 178..234 CDD:280357 12/56 (21%)
TRAF_BIRC3_bd 265..325 CDD:406958 6/46 (13%)
MATH_TRAF2 330..493 CDD:239747
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.