DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elgi and Rnf151

DIOPT Version :9

Sequence 1:NP_001261904.1 Gene:elgi / 39735 FlyBaseID:FBgn0283649 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001100457.1 Gene:Rnf151 / 302977 RGDID:1309302 Length:238 Species:Rattus norvegicus


Alignment Length:212 Identity:63/212 - (29%)
Similarity:87/212 - (41%) Gaps:44/212 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GYDVNRFQGEVDEELTCPICSGVLEDPLQAVMCEHAFCRGCINEWLTRQPTCPVDRNSLTTANLR 66
            |||:|.|....|....|.:|.|||:.|:: :.|.|.||:.||.:||.||.|||..|..:....:.
  Rat     4 GYDLNLFASPPDCNFLCSVCHGVLKRPMR-LPCSHIFCKKCIFQWLARQNTCPCCRKEVKRRKMV 67

  Fly    67 AVPRILRNLLSRLSITCDNAPYGCTAVLKLDAYNSHLDECIHNPKRPFP---------------- 115
            .|.: ||..:.||.:.|.||..||.....|.....|.|.|      ||.                
  Rat    68 QVNK-LRKTIGRLQVKCKNAAAGCLVTCPLAHRKGHQDSC------PFELMACPNEGCTAQVLRG 125

  Fly   116 ----------------CEKGCGFDIPKDELKDHNCVRELRTLIVKQTEKMGELKSELTDQ----Q 160
                            |..|||..:...|.:.|||.||||...|::.|:...|...|..:    .
  Rat   126 VLDEHRQHCQQNGQQRCPLGCGATLAALEGEQHNCYRELRDAWVQRHERNRTLLLNLLGRVRRVY 190

  Fly   161 LTINELKRELQLFKDFM 177
            .|.|.::|:|....:|:
  Rat   191 RTTNLIRRQLAQLSNFL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elgiNP_001261904.1 RING 17..55 CDD:238093 18/37 (49%)
Sina 83..>157 CDD:302762 26/105 (25%)
USP8_interact 137..315 CDD:286082 12/45 (27%)
Rnf151NP_001100457.1 RING_Ubox 20..58 CDD:418438 19/38 (50%)
Sina 83..>134 CDD:418524 11/56 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.