DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment elgi and PDZRN4

DIOPT Version :9

Sequence 1:	NP_001261904.1	Gene:	elgi / 39735	FlyBaseID:	FBgn0283649	Length:	315	Species:	Drosophila melanogaster
Sequence 2:	NP_001158067.1	Gene:	PDZRN4 / 29951	HGNCID:	30552	Length:	1036	Species:	Homo sapiens

Alignment Length:	131	Identity:	44/131 - (33%)
Similarity:	63/131 - (48%)	Gaps:	9/131 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly     1 MGYDVNRFQGEVDEELTCPICSGVLEDPLQAVMCEHAFCRGCINEWLTRQPTCPVDRNSLTTANL 65
            ||:.:.||...||..|.|.:|..|||:|| ...|.|.||..|:..|..|:..||:....|....|
Human     1 MGFALERFAEAVDPALECKLCGQVLEEPL-CTPCGHVFCASCLLPWAVRRRRCPLQCQPLAPGEL 64

  Fly    66 -RAVPRILRNLLSRLSITCDNAPYGCTAVLKLDAYNSHLDECIHNPKRPFPCEKGC-----GFDI 124
             |.:|  ||:|:.:|.:.||....||...::|....:|::.|...|.|......||     |.::
Human    65 YRVLP--LRSLIQKLRVQCDYRARGCGHSVRLHELEAHVEHCDFGPARRLRSRGGCASGLGGGEV 127

  Fly   125 P 125
            |
Human   128 P 128

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
elgi	NP_001261904.1	RING	17..55	CDD:238093	15/37 (41%)
		Sina	83..>157	CDD:302762	13/48 (27%)
		USP8_interact	137..315	CDD:286082
PDZRN4	NP_001158067.1	RING	17..54	CDD:238093	15/37 (41%)
		Sina	66..>108	CDD:302762	13/43 (30%)
		PDZ	221..313	CDD:214570
		PDZ_signaling	402..484	CDD:238492
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0297
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810