Sequence 1: | NP_001261904.1 | Gene: | elgi / 39735 | FlyBaseID: | FBgn0283649 | Length: | 315 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001165584.1 | Gene: | Traf7 / 224619 | MGIID: | 3042141 | Length: | 669 | Species: | Mus musculus |
Alignment Length: | 250 | Identity: | 59/250 - (23%) |
---|---|---|---|
Similarity: | 87/250 - (34%) | Gaps: | 63/250 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 FQGEVDEELTCPICSGVLEDPLQAVMCEHAFCRGCINEWLTRQPTCPVDRNSLT-TANLRAVPRI 71
Fly 72 LRNLLSRLSITCDNA-----------PYGCTAVLKLDAYNSHLDECIHNPKR--------PF--- 114
Fly 115 -------PCEK--------GCGFDIPKDELKDH--NC---------------VRELRTLIVKQTE 147
Fly 148 KMGELKSELTDQQLTINELKRELQLFKDFM--RAMRVSNPAMRAIAD-QMERDEV 199 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
elgi | NP_001261904.1 | RING | 17..55 | CDD:238093 | 12/37 (32%) |
Sina | 83..>157 | CDD:302762 | 24/127 (19%) | ||
USP8_interact | 137..315 | CDD:286082 | 15/65 (23%) | ||
Traf7 | NP_001165584.1 | RING | 130..162 | CDD:214546 | 12/36 (33%) |
Sina | 206..>279 | CDD:302762 | 18/72 (25%) | ||
DD_cGKI | 281..321 | CDD:213458 | 5/39 (13%) | ||
WD40 | <379..667 | CDD:225201 | |||
WD40 | 387..667 | CDD:238121 | |||
WD40 repeat | 442..476 | CDD:293791 | |||
WD40 repeat | 481..516 | CDD:293791 | |||
WD40 repeat | 526..555 | CDD:293791 | |||
WD40 repeat | 561..595 | CDD:293791 | |||
WD40 repeat | 603..638 | CDD:293791 | |||
WD40 repeat | 645..667 | CDD:293791 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0297 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |