DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elgi and Traf7

DIOPT Version :9

Sequence 1:NP_001261904.1 Gene:elgi / 39735 FlyBaseID:FBgn0283649 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001165584.1 Gene:Traf7 / 224619 MGIID:3042141 Length:669 Species:Mus musculus


Alignment Length:250 Identity:59/250 - (23%)
Similarity:87/250 - (34%) Gaps:63/250 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FQGEVDEELTCPICSGVLEDPLQAVMCEHAFCRGCINEWLTRQPTCPVDRNSLT-TANLRAVPRI 71
            |..:...:|.|.:|..|.:||: ...|.|.|||.|    ..:...||||...|| ..|..||...
Mouse   120 FAEQPSVKLCCQLCCSVFKDPV-ITTCGHTFCRRC----ALKSEKCPVDNAKLTVVVNNIAVAEQ 179

  Fly    72 LRNLLSRLSITCDNA-----------PYGCTAVLKLDAYNSHLDECIHNPKR--------PF--- 114
            :..|.......|..|           |.||...:||.|...|...|.:.|.|        |.   
Mouse   180 IGELFIHCRHGCHAAGTGKPGVFEVDPRGCPFTIKLSARKDHESSCDYRPVRCPNNPSCPPLLKM 244

  Fly   115 -------PCEK--------GCGFDIPKDELKDH--NC---------------VRELRTLIVKQTE 147
                   .||.        ||.|...:|..:.|  .|               ..|:...:.::.:
Mouse   245 NLEAHLKECEHIKCPHSKYGCTFIGNQDTYETHLETCRFEGLKEFLQQTDDRFHEMHVALAQKDQ 309

  Fly   148 KMGELKSELTDQQLTINELKRELQLFKDFM--RAMRVSNPAMRAIAD-QMERDEV 199
            ::..|:|.|......|::|::.|:|..|.:  ...::|...|....| .|..||:
Mouse   310 EIAFLRSMLGKLSEKIDQLEKSLELKFDVLDENQSKLSEDLMEFRRDASMLNDEL 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elgiNP_001261904.1 RING 17..55 CDD:238093 12/37 (32%)
Sina 83..>157 CDD:302762 24/127 (19%)
USP8_interact 137..315 CDD:286082 15/65 (23%)
Traf7NP_001165584.1 RING 130..162 CDD:214546 12/36 (33%)
Sina 206..>279 CDD:302762 18/72 (25%)
DD_cGKI 281..321 CDD:213458 5/39 (13%)
WD40 <379..667 CDD:225201
WD40 387..667 CDD:238121
WD40 repeat 442..476 CDD:293791
WD40 repeat 481..516 CDD:293791
WD40 repeat 526..555 CDD:293791
WD40 repeat 561..595 CDD:293791
WD40 repeat 603..638 CDD:293791
WD40 repeat 645..667 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.