DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elgi and Traf6

DIOPT Version :9

Sequence 1:NP_001261904.1 Gene:elgi / 39735 FlyBaseID:FBgn0283649 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001290202.1 Gene:Traf6 / 22034 MGIID:108072 Length:530 Species:Mus musculus


Alignment Length:334 Identity:63/334 - (18%)
Similarity:104/334 - (31%) Gaps:140/334 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GYDVNRFQGEVDEELTCPICSGVLEDPLQAVMCEHAFCRGCINEWL-TRQPTCPVDRNSLTTANL 65
            |||| .|...::.:..||||...|.:.:| ..|.|.||:.||.:.: .....||||...|....|
Mouse    55 GYDV-EFDPPLESKYECPICLMALREAVQ-TPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQL 117

  Fly    66 RAVPRILRNLLSRLSITCDNAPYGCTAVLKLDAYNSH---------------------------L 103
            .......|.:|| |::.|.|.  ||...::|.....|                           :
Mouse   118 FPDNFAKREILS-LTVKCPNK--GCLQKMELRHLEDHQVHCEFALVNCPQCQRPFQKCQVNTHII 179

  Fly   104 DEC--------------------IHN------------------------------PKRPFPCE- 117
            ::|                    ||:                              |..|.||. 
Mouse   180 EDCPRRQVSCVNCAVSMAYEEKEIHDQSCPLANIICEYCGTILIREQMPNHYDLDCPTAPIPCTF 244

  Fly   118 --KGCGFDIPKDELKDH---------------------------------NC----------VRE 137
              .||...:.::.|..|                                 .|          :::
Mouse   245 SVFGCHEKMQRNHLARHLQENTQLHMRLLAQAVHNVNLALRPCDAASPSRGCRPEDPNYEETIKQ 309

  Fly   138 LRTLIVKQTEKMGELKSELTDQQLTINELKRELQLFKDFMRAM-----------RVSNPAMRAIA 191
            |.:.:|:|..::.||.:::..|.:.:.||||.::..:|.:..|           ::.|..|...:
Mouse   310 LESRLVRQDHQIRELTAKMETQSMYVGELKRTIRTLEDKVAEMEAQQCNGIYIWKIGNFGMHLKS 374

  Fly   192 DQMERDEVI 200
            .:.||..||
Mouse   375 QEEERPVVI 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elgiNP_001261904.1 RING 17..55 CDD:238093 13/38 (34%)
Sina 83..>157 CDD:302762 23/196 (12%)
USP8_interact 137..315 CDD:286082 18/75 (24%)
Traf6NP_001290202.1 Interaction with TAX1BP1. /evidence=ECO:0000250 1..362 57/311 (18%)
RING 69..107 CDD:238093 13/38 (34%)
zf-TRAF 204..261 CDD:280357 8/56 (14%)
SlyX 304..>356 CDD:294687 12/51 (24%)
MATH_TRAF6 359..508 CDD:239745 6/25 (24%)
Interaction with TANK. /evidence=ECO:0000250|UniProtKB:Q9Y4K3 363..530 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.