DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elgi and Traf5

DIOPT Version :9

Sequence 1:NP_001261904.1 Gene:elgi / 39735 FlyBaseID:FBgn0283649 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_035763.2 Gene:Traf5 / 22033 MGIID:107548 Length:558 Species:Mus musculus


Alignment Length:293 Identity:73/293 - (24%)
Similarity:108/293 - (36%) Gaps:82/293 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RFQGEVDEELTCPICSGVLEDPLQAVMCEHAFCRGCINEW--LTRQPTCPVDRNSLTTANLRAVP 69
            :|..:::|...|..|..||.:|.| ..|.|.||:.||...  |...|.||||:..:....:....
Mouse    34 QFVEQLEERYKCAFCHSVLHNPHQ-TGCGHRFCQQCIRSLRELNSVPICPVDKEVIKPQEVFKDN 97

  Fly    70 RILRNLLSRLSITCDNAPYGCTAVLKLDAYNSHLDECIHNPKRPFPC-EKGCGFDIPKDELKDH- 132
            ...|.:|: |.:.|.||| ||.|.:.|..:..||..|..   :..|| .:.|...:.:.::|:| 
Mouse    98 CCKREVLN-LHVYCKNAP-GCNARIILGRFQDHLQHCSF---QAVPCPNESCREAMLRKDVKEHL 157

  Fly   133 ---------NCVRELRTLIVKQTEKMGELKSELTDQQLTINELKRELQLFKDFMRAMRVSNPAMR 188
                     .|:...|.::|          :.|.|.:             ::...|..||.|.  
Mouse   158 SAYCRFREEKCLYCKRDIVV----------TNLQDHE-------------ENSCPAYPVSCPN-- 197

  Fly   189 AIADQMERDEVIRWSSTLPRARVTRWGGMISTPDDALQLMIKRALSESGCP-PHI-------LDS 245
                        |...|:|||||..  .:...|:           :|..|| .|.       ..:
Mouse   198 ------------RCVQTIPRARVNE--HLTVCPE-----------AEQDCPFKHYGCTVKGKRGN 237

  Fly   246 LMEFCHERR--WPRGLSSLETR-QTNRRIYDNY 275
            |:|  |||.  ....|..||.. |..:||.|.|
Mouse   238 LLE--HERAALQDHMLLVLEKNYQLEQRISDLY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elgiNP_001261904.1 RING 17..55 CDD:238093 15/39 (38%)
Sina 83..>157 CDD:302762 19/84 (23%)
USP8_interact 137..315 CDD:286082 33/150 (22%)
Traf5NP_035763.2 mRING-HC-C3HC3D_TRAF5 43..85 CDD:319556 17/42 (40%)
zf-TRAF 128..183 CDD:280357 12/67 (18%)
zf-TRAF 185..241 CDD:424248 18/84 (21%)
Smc <237..>419 CDD:224117 13/34 (38%)
Interaction with EIF2AK2/PKR. /evidence=ECO:0000250 345..558
MATH_TRAF5 404..551 CDD:239749
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.