DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elgi and Traf1

DIOPT Version :9

Sequence 1:NP_001261904.1 Gene:elgi / 39735 FlyBaseID:FBgn0283649 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001313530.1 Gene:Traf1 / 22029 MGIID:101836 Length:409 Species:Mus musculus


Alignment Length:342 Identity:63/342 - (18%)
Similarity:103/342 - (30%) Gaps:132/342 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DEELTCPICSG----------------VLEDPLQA-VMCEHAFCRGC------------------ 42
            ||:..||.|..                |..|..:| :||..|.. ||                  
Mouse    43 DEDRICPKCRADNLHPVSPGSPLTQEKVHSDVAEAEIMCPFAGV-GCSFKGSPQSMQEHEATSQS 106

  Fly    43 ---------INEWLTRQPTCPVDRNSLTTANLRAVPRILRNLLSRLSITCDNAPYGCTAVLKLDA 98
                     :.||           .|...:||.:.|..|...||.|.:   .|....|..|::|.
Mouse   107 SHLYLLLAVLKEW-----------KSSPGSNLGSAPMALERNLSELQL---QAAVEATGDLEVDC 157

  Fly    99 YNSHLDECIHNPKRPFPCEKGCGFDIPKDELKDHNCVRELRTLIVKQTEKMGELKSELTDQQLT- 162
            |.:             ||                 |                |.:.||..|.|. 
Mouse   158 YRA-------------PC-----------------C----------------ESQEELALQHLVK 176

  Fly   163 ---INELKRELQLFKDFM----RAMRVSNPAMRAI--ADQMERDEVIRWSSTLPRARVTRWGGMI 218
               :.:|:.:|::|.:.:    :.:..|:.|:.|.  ..|::|:.::....     ||......:
Mouse   177 EKLLAQLEEKLRVFANIVAVLNKEVEASHLALAASIHQSQLDREHILSLEQ-----RVVELQQTL 236

  Fly   219 STPDDAL-----QLMIKRALSESGCPPHILDSLMEFCHERRWPRGLSSLETRQTNRRIYDNYVCR 278
            :..|..|     .|.:....|..|.....:.::.:.|||....|.:|.........: |...:|.
Mouse   237 AQKDQVLGKLEHSLRLMEEASFDGTFLWKITNVTKRCHESVCGRTVSLFSPAFYTAK-YGYKLCL 300

  Fly   279 RI------PGKQAVLVL 289
            |:      .||:..|.|
Mouse   301 RLYLNGDGSGKKTHLSL 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elgiNP_001261904.1 RING 17..55 CDD:238093 13/81 (16%)
Sina 83..>157 CDD:302762 10/73 (14%)
USP8_interact 137..315 CDD:286082 32/174 (18%)
Traf1NP_001313530.1 SMC_prok_B <126..257 CDD:274008 33/184 (18%)
TRAF_BIRC3_bd 180..237 CDD:374713 10/61 (16%)
MATH_TRAF1 260..406 CDD:239748 13/59 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.