DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elgi and trf-2

DIOPT Version :9

Sequence 1:NP_001261904.1 Gene:elgi / 39735 FlyBaseID:FBgn0283649 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_491534.2 Gene:trf-2 / 172151 WormBaseID:WBGene00022454 Length:335 Species:Caenorhabditis elegans


Alignment Length:128 Identity:28/128 - (21%)
Similarity:44/128 - (34%) Gaps:57/128 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 PFPCEKGCGFDIPKDELKDHNCVRELRTLIVKQTEKMGELKSELTDQQLTINELKRELQLFKDFM 177
            ||.|:  ..|.|..|:                        |.||..:.:.:||:. |:|.|    
 Worm   232 PFRCD--VTFSILSDD------------------------KKELLTKTIYVNEMP-EIQEF---- 265

  Fly   178 RAMRVSNPAMRAIADQMERDEVIR-----WSSTLPRARVTRWGGMISTPDDALQLMIKRALSE 235
                            :||.|.:|     :.:.||.|:||.:..     |..:.:.||..||:
 Worm   266 ----------------LERPEGLRNGTFGFQNFLPLAKVTEFAA-----DGDIFIQIKVLLSK 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elgiNP_001261904.1 RING 17..55 CDD:238093
Sina 83..>157 CDD:302762 8/43 (19%)
USP8_interact 137..315 CDD:286082 22/104 (21%)
trf-2NP_491534.2 MATH_TRAF_C 158..304 CDD:238168 26/123 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.