DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elgi and trf-2

DIOPT Version :10

Sequence 1:NP_648816.1 Gene:elgi / 39735 FlyBaseID:FBgn0283649 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_491534.2 Gene:trf-2 / 172151 WormBaseID:WBGene00022454 Length:335 Species:Caenorhabditis elegans


Alignment Length:128 Identity:28/128 - (21%)
Similarity:44/128 - (34%) Gaps:57/128 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 PFPCEKGCGFDIPKDELKDHNCVRELRTLIVKQTEKMGELKSELTDQQLTINELKRELQLFKDFM 177
            ||.|:  ..|.|..|:                        |.||..:.:.:||:. |:|.|    
 Worm   232 PFRCD--VTFSILSDD------------------------KKELLTKTIYVNEMP-EIQEF---- 265

  Fly   178 RAMRVSNPAMRAIADQMERDEVIR-----WSSTLPRARVTRWGGMISTPDDALQLMIKRALSE 235
                            :||.|.:|     :.:.||.|:||.:..     |..:.:.||..||:
 Worm   266 ----------------LERPEGLRNGTFGFQNFLPLAKVTEFAA-----DGDIFIQIKVLLSK 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elgiNP_648816.1 mRING-HC-C3HC3D_Nrdp1 15..57 CDD:438296
USP8_interact 137..315 CDD:430333 22/104 (21%)
trf-2NP_491534.2 MATH_TRAF_C 158..304 CDD:238168 26/123 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.