DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elgi and traf1

DIOPT Version :9

Sequence 1:NP_001261904.1 Gene:elgi / 39735 FlyBaseID:FBgn0283649 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_031747100.1 Gene:traf1 / 101734662 XenbaseID:XB-GENE-22069371 Length:549 Species:Xenopus tropicalis


Alignment Length:130 Identity:34/130 - (26%)
Similarity:52/130 - (40%) Gaps:18/130 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 EELTCPICSGVLEDPLQAVMCEHAFCRGCINEWLTRQ-----PTCPV-DRNSLTTANLRAVPR-- 70
            |:..|..|..||: ..|..:|.|.:|..|: .|:..:     |.|.. |..:|:..:|....|  
 Frog    36 EKYLCCSCKNVLK-KAQQTLCGHRYCTPCL-VWIVSRNHDLCPKCKAEDPTTLSDDSLLKEERAF 98

  Fly    71 ---ILRNLLSRLSITCDNAPYGCTAVLKLDAYNSHLDECIHNPKRPFPCEKGCGFDIPKDELKDH 132
               .:...:|.|.:.|  ...|||....:..|..|...|.:   ...||..|||..:.:.:|.||
 Frog    99 SDAAINKEISELKVHC--VIPGCTWRGLMRDYEEHESLCNY---ALIPCHTGCGHRVMRKQLADH 158

  Fly   133  132
             Frog   159  158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elgiNP_001261904.1 RING 17..55 CDD:238093 12/42 (29%)
Sina 83..>157 CDD:302762 15/50 (30%)
USP8_interact 137..315 CDD:286082
traf1XP_031747100.1 RING_Ubox 38..79 CDD:418438 11/42 (26%)
RAD18 39..>214 CDD:227719 33/127 (26%)
TRAF_BIRC3_bd 317..377 CDD:406958
MATH 400..546 CDD:351761
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.