DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elgi and rnf151

DIOPT Version :9

Sequence 1:NP_001261904.1 Gene:elgi / 39735 FlyBaseID:FBgn0283649 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_004918118.1 Gene:rnf151 / 101733072 XenbaseID:XB-GENE-6467161 Length:212 Species:Xenopus tropicalis


Alignment Length:222 Identity:67/222 - (30%)
Similarity:95/222 - (42%) Gaps:39/222 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GYDVNRFQGEVDEELTCPICSGVLEDPLQAVMCEHAFCRGCINEWLTRQPTCPVDRNSLTTANLR 66
            |||:..|....|.:|.|.||.||:..|:. :.|.|.|||.||.:||.||.|||..|..: ...|.
 Frog     4 GYDIELFTKTPDYDLLCSICHGVMRCPVM-ISCGHIFCRNCIMQWLKRQRTCPCCRTEV-RGKLY 66

  Fly    67 AVPRILRNLLSRLSITCDNAPYGCTAVLKLDAYNSHLDEC------------------------I 107
            .:...|:..::||.:.|.|...||.|...|.....|.:.|                        |
 Frog    67 VLMHKLKRKINRLDVKCPNEQNGCPAHFALVHSQEHAEYCAYGAVPCSNEGCPAEVLRKDMCDHI 131

  Fly   108 HNPK--RPFPCEKGCGFDIPKDELKDHNCVRELRTLIVKQTEKMGELKSELTDQQLTINELKREL 170
            ||.:  |.. |..|||..:..:..:.|||.:||:....||..|   ||.:....:....::.|:|
 Frog   132 HNCRYWRQH-CHMGCGTLLHPENRETHNCYQELKEDYAKQLYK---LKQKANRMETICCQISRQL 192

  Fly   171 QLFKDFMRAMRVSNPAMRAIADQMERD 197
            |:..|   :|..:.||    ||..|.:
 Frog   193 QMMND---SMETAQPA----ADTGETE 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elgiNP_001261904.1 RING 17..55 CDD:238093 19/37 (51%)
Sina 83..>157 CDD:302762 26/99 (26%)
USP8_interact 137..315 CDD:286082 17/61 (28%)
rnf151XP_004918118.1 RING 20..61 CDD:238093 21/41 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.