DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elgi and traf2

DIOPT Version :9

Sequence 1:NP_001261904.1 Gene:elgi / 39735 FlyBaseID:FBgn0283649 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_031746908.1 Gene:traf2 / 100494415 XenbaseID:XB-GENE-493460 Length:527 Species:Xenopus tropicalis


Alignment Length:195 Identity:44/195 - (22%)
Similarity:69/195 - (35%) Gaps:68/195 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DVNR--FQGEV-----DEELTCPICSGVLEDPLQAVMCEHAFCRGCINEWLTRQP-TCPV----- 55
            |:|:  |:.|:     :.:..|..|..:|..|||| .|.|.:|..|:|:.::..| .|..     
 Frog    16 DLNQPGFKKEILGTKLEVKYLCSDCKNLLRRPLQA-QCGHRYCSHCLNKIISTGPQKCSACIQEG 79

  Fly    56 ---DRNSLTTANLRAVPRILRNLLSRLSITCDN-------------------APY------GCTA 92
               |..||..::........|..:..|...|:|                   .||      .|..
 Frog    80 IYEDGVSLLESSTAFPDNAARREVESLPAICNNNGCNWRGTIKEYEVGHEGKCPYLLAPCPACKT 144

  Fly    93 VLKLDAYNSHLD-EC--------------------IHN---PKRPFPCEKGCG-FDIPKDELKDH 132
            :::....:.|.: ||                    .|:   ||.|..|| ||| ..||:::..||
 Frog   145 LIRAANRDLHSERECPERKLNCRYCKLSFYFPDIKAHDEICPKFPMTCE-GCGRKKIPREKFPDH 208

  Fly   133  132
             Frog   209  208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elgiNP_001261904.1 RING 17..55 CDD:238093 14/38 (37%)
Sina 83..>157 CDD:302762 21/100 (21%)
USP8_interact 137..315 CDD:286082
traf2XP_031746908.1 RING-HC_TRAF2 35..76 CDD:319553 14/41 (34%)
zf-TRAF 181..238 CDD:280357 13/29 (45%)
TRAF_BIRC3_bd 295..355 CDD:406958
MATH 362..523 CDD:351761
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.