DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elgi and traf5

DIOPT Version :9

Sequence 1:NP_001261904.1 Gene:elgi / 39735 FlyBaseID:FBgn0283649 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_004914139.2 Gene:traf5 / 100491604 XenbaseID:XB-GENE-985638 Length:555 Species:Xenopus tropicalis


Alignment Length:148 Identity:42/148 - (28%)
Similarity:66/148 - (44%) Gaps:17/148 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FQGEVDEELTCPICSGVLEDPLQAVMCEHAFCRGCINEW--LTRQPTCPVDRNSLTTANL---RA 67
            |..::.:...|..|..||.:|.| ..|.|.||..||:..  |:..|.||:|..::.:..:   ..
 Frog    34 FVEQLQDRYKCASCHLVLHNPHQ-TGCGHRFCEKCISNLIELSETPQCPIDMENIKSHEIFKDNC 97

  Fly    68 VPRILRNLLSRLSITCDNAPYGCTAVLKLDAYNSHLDECIHNPKRPFPCEKGCGFDIPKDELKDH 132
            ..|.:.|||    :.|.|:| .|...:.|..|..||.:|::  :.......||...:.:.|||.|
 Frog    98 CKREVLNLL----VYCKNSP-ACDVKVMLGRYQEHLGQCLY--EMTLCSNDGCHDQMIRKELKGH 155

  Fly   133 ---NC-VRELRTLIVKQT 146
               .| :|:...:..|||
 Frog   156 LESECKLRQEACIYCKQT 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elgiNP_001261904.1 RING 17..55 CDD:238093 15/39 (38%)
Sina 83..>157 CDD:302762 20/68 (29%)
USP8_interact 137..315 CDD:286082 3/10 (30%)
traf5XP_004914139.2 mRING-HC-C3HC3D_TRAF5 42..84 CDD:319556 16/42 (38%)
zf-TRAF 127..182 CDD:424248 14/49 (29%)
zf-TRAF 187..240 CDD:424248
MATH 400..548 CDD:351761
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.