DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elgi and rnf41

DIOPT Version :9

Sequence 1:NP_001261904.1 Gene:elgi / 39735 FlyBaseID:FBgn0283649 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_002934542.1 Gene:rnf41 / 100489964 XenbaseID:XB-GENE-943148 Length:317 Species:Xenopus tropicalis


Alignment Length:315 Identity:183/315 - (58%)
Similarity:253/315 - (80%) Gaps:0/315 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGYDVNRFQGEVDEELTCPICSGVLEDPLQAVMCEHAFCRGCINEWLTRQPTCPVDRNSLTTANL 65
            |||||:||||:|||:|.|||||||||:|:||..||||||..||.:|.::|.||||||:.:|.|:|
 Frog     1 MGYDVSRFQGDVDEDLICPICSGVLEEPVQAPHCEHAFCNACITQWFSQQQTCPVDRSVVTVAHL 65

  Fly    66 RAVPRILRNLLSRLSITCDNAPYGCTAVLKLDAYNSHLDECIHNPKRPFPCEKGCGFDIPKDELK 130
            |.||||:||:||:|.||||||.:|||.:::||...|||.:|.||||||..||:|||.::|||||.
 Frog    66 RPVPRIMRNMLSKLQITCDNAVFGCTTIVRLDNLMSHLSDCEHNPKRPVTCEQGCGLEMPKDELP 130

  Fly   131 DHNCVRELRTLIVKQTEKMGELKSELTDQQLTINELKRELQLFKDFMRAMRVSNPAMRAIADQME 195
            :|||::.||:::.:|..::|||:....:.:..::|.||::||.|.:|||:|.:||.::.:.:.:|
 Frog   131 NHNCIKHLRSVVQQQQIRIGELEKAAAESKHQLSEQKRDIQLLKAYMRAIRSANPNLQNLEETIE 195

  Fly   196 RDEVIRWSSTLPRARVTRWGGMISTPDDALQLMIKRALSESGCPPHILDSLMEFCHERRWPRGLS 260
            .:|::.|.::|..||||||||||||||..||.:|||:|.|||||..|::.|:|..|||.||:||:
 Frog   196 YNEILEWVNSLQPARVTRWGGMISTPDAVLQAVIKRSLVESGCPASIVNELIENAHERNWPQGLA 260

  Fly   261 SLETRQTNRRIYDNYVCRRIPGKQAVLVLSCDNLHMTEDVMIDPGLVMIFAHGIE 315
            :|||||.|||.|:|||.:||||||||:|::|:|.||.||::::||||||||||:|
 Frog   261 TLETRQMNRRYYENYVAKRIPGKQAVVVMACENQHMGEDMVLEPGLVMIFAHGVE 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elgiNP_001261904.1 RING 17..55 CDD:238093 24/37 (65%)
Sina 83..>157 CDD:302762 38/73 (52%)
USP8_interact 137..315 CDD:286082 94/177 (53%)
rnf41XP_002934542.1 mRING-HC-C3HC3D_Nrdp1 15..57 CDD:319548 27/41 (66%)
modified RING-HC finger (C3HC3D-type) 18..56 CDD:319548 25/37 (68%)
USP8_interact 137..315 CDD:370198 94/177 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 211 1.000 Domainoid score I2757
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4226
Inparanoid 1 1.050 364 1.000 Inparanoid score I2127
OMA 1 1.010 - - QHG48595
OrthoDB 1 1.010 - - D422158at33208
OrthoFinder 1 1.000 - - FOG0007809
OrthoInspector 1 1.000 - - oto104944
Panther 1 1.100 - - LDO PTHR15315
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5674
SonicParanoid 1 1.000 - - X5758
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.