DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elgi and traf1

DIOPT Version :9

Sequence 1:NP_001261904.1 Gene:elgi / 39735 FlyBaseID:FBgn0283649 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001121853.1 Gene:traf1 / 100148503 ZFINID:ZDB-GENE-071120-4 Length:551 Species:Danio rerio


Alignment Length:311 Identity:67/311 - (21%)
Similarity:107/311 - (34%) Gaps:97/311 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 EELTCPICSGVLEDPLQAVMCEHAFCRGCINEWLTRQ------PTCPVDRNSLTTANLRAVPR-- 70
            ::..|..|:.||....|.| |.|.:|..|:| ||.|.      ..|..:.:::.:......|.  
Zfish    38 DKYLCSNCNNVLNKARQTV-CGHRYCLACVN-WLVRNNKDLVCTKCKGEDSNVESDTSVLTPNQF 100

  Fly    71 -----ILRNLLSRLSITCDNAPYGCTAVLKLDAYNSHLDECIHNPKRPFPCEKGCGFDIPKDELK 130
                 |.:.:|. |.:.|.|  .||.....|..:..|..:|.:   ...||..|||..:.:..|.
Zfish   101 FNDVAINKEILD-LKVHCAN--QGCPWRSTLKNFEDHQSQCEY---ALIPCNIGCGIMVQRKTLA 159

  Fly   131 DH-------------NCV-----RELRTLIVKQTEKMGELKSELTDQQ----LTINELKRE---- 169
            .|             :|.     |||:..:...:   |:.|:..||::    ...|..|:|    
Zfish   160 THLESGCPNNKTACPSCTSVLTPRELQKHVCPSS---GDKKTAKTDKKQKNNQPANSKKKEPCIF 221

  Fly   170 -------------------------LQLFKDFMRAM-RVSNPAMRAIADQMERDEVI------RW 202
                                     |||..|..||: |..|.|    .:::.:|..:      ..
Zfish   222 SDVGCPFKGNPDKVKEHESCSHAGHLQLLLDVTRALQRTLNSA----TERVYQDSPVFLEPGPNG 282

  Fly   203 SSTLPRA--RVTRWGGMISTPDDALQL---MIKRALSESGCPPHILDSLME 248
            ||..|:|  .:...||.....|.|..|   .::.|..:.      ||:|.:
Zfish   283 SSLAPQADGDIETDGGDPGVSDKAFSLHDDQVELAAGQQ------LDALQQ 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elgiNP_001261904.1 RING 17..55 CDD:238093 15/43 (35%)
Sina 83..>157 CDD:302762 20/91 (22%)
USP8_interact 137..315 CDD:286082 32/157 (20%)
traf1NP_001121853.1 zf-TRAF 134..188 CDD:280357 13/56 (23%)
TRAF_BIRC3_bd 320..375 CDD:293278 3/14 (21%)
MATH_TRAF1 402..548 CDD:239748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.